Overview
NameMa01_t01560.1
Unique NameMa01_t01560.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length108
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1079290..1080639 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteUncharacterized protein
OriginCIRAD:GSMUA_Achr1T06260_001
Old locus tagGSMUA_Achr1G06260_001
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma01_g01560Ma01_g01560Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma01_p01560.1Ma01_p01560.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto1429238auto1429238Musa acuminataCDS
CDS-auto1429239auto1429239Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto1429240auto1429240Musa acuminataexon
exon-auto1429241auto1429241Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma01_t01560.1 ID=Ma01_t01560.1|Name=Ma01_t01560.1|organism=Musa acuminata|type=mRNA|length=108bp
ATGGCGCCGTCGTCGACCTCGTATCCTCCGTTGAGTTCTGCATCGACCGA
ACGTGTCCCTCAGCAGCTGAGGGTGGGAAGTGTAAGGGGTCTGGGTTTTT
CGATTTGA
back to top

protein sequence of Ma01_p01560.1

>Ma01_p01560.1 ID=Ma01_p01560.1|Name=Ma01_p01560.1|organism=Musa acuminata|type=polypeptide|length=36bp
MAPSSTSYPPLSSASTERVPQQLRVGSVRGLGFSI*
back to top

mRNA from alignment at chr01:1079290..1080639+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma01_t01560.1 ID=Ma01_t01560.1|Name=Ma01_t01560.1|organism=Musa acuminata|type=mRNA|length=1350bp|location=Sequence derived from alignment at chr01:1079290..1080639+ (Musa acuminata)
ATGGCGCCGTCGTCGACCTCGTATCCTCCGTTGAGTTCTGCATCGACCGA ACGTGTCCCTCAGGTCTGTTTCTTGAAATCCTTTTGGGAATTCGGTGTGG GTGCTTGTTCTTTCATGGCATCTGCTTTTAGACGGAGCCCTTTTGTTTCG GGGCATGATTGCTACCTTCTTTTTTGGATCTTCTTATTGAACCGTCCTCG TGAGATCATGTCATCGTTTTTTGGGAATTCTTTGCGTTCAATTGCGTTCT CTTTTGATTGGTACATGCTTTAATCCGGAATGTTTTTGTTTTGGGGATGA TCGTTGTCTTCGTCCTCCATGGATTCGTTTTCTCGTGAGATCTGTTTCTT GAAATATTTTGGGGAATTCTTTTTTAGTTGTTCCTCTGCGATTGGTGCTT GCTTTTGTTTTTGTAATGGGTAACGATTGGTATTTCCTTTTATGGATTCC TTTCCTTGGATTCTTCTCGTGGGATCATGTCATCGATAGAACGAACTTGT TGACTTCTCTGGTTGCTTTACGCTACTCTGCGGAGATGAGATGAATTCTC TATTATAACTTCCTGTGTTTTCTTTTGGACACCTTTTCTATCATCCGGTA AAGATATCTTCCTGTATTATCCTCTTTATGGTATTTGGTATGTGATCATC TCCGTGGACTCTGAAAAATCACTTTCTAGGAATCAGCTTTTGGTACTTTA TATCAATTATTTAGGTTAGTCATGTTAAAGGAGCAATGATCCTGTATCTG TTGATGTCTGTTTCCCACCTGTATCGTTTTTCTCCAATTTGTTCCTGTTG GTTGTTGCTTCTTTTCTTGGTTAATTAGGCAAAATTTGTTGCATGATGCA TAATATAGTGACTATAGTCTTGCCATAAGGATGTCATTGTTTCTTTCGAA TTCTTCATATCATTCGTTCTACATATGTACAAGTTGTTCGTTAAGCACCT TAATTCTTCACTACGATTTTGCACTAAGTGTTAGCCACCTTTAGAGGATC GTTTACTTTTAGTCATAACATTAGATTTTGCGGTATGAAATATGAATGAC AGCAATGCTTACTGTGGATCATTGATTCAATTCATGTGGTCCTAGACCTA GATGCAAGTGATCTGTTCGTGGAGGTGGACTTTATGGTCCTCTTGAAAGT TGTTTATGACTCGTGCTTATATCTTTCTCGGTGATGCTATTTTATCATGT ATATCATTTTGAAAGCTTTTGGAATATGATTAAGGGCATTAGTTGGCATA GGAATAACTATTATATGCGATGTTTGTGAAATTTGGTACCATTTTGAAGT TGCAGCAGCTGAGGGTGGGAAGTGTAAGGGGTCTGGGTTTTTCGATTTGA
back to top

Coding sequence (CDS) from alignment at chr01:1079290..1080639+

>Ma01_t01560.1 ID=Ma01_t01560.1|Name=Ma01_t01560.1|organism=Musa acuminata|type=CDS|length=108bp|location=Sequence derived from alignment at chr01:1079290..1080639+ (Musa acuminata)
ATGGCGCCGTCGTCGACCTCGTATCCTCCGTTGAGTTCTGCATCGACCGA
ACGTGTCCCTCAGCAGCTGAGGGTGGGAAGTGTAAGGGGTCTGGGTTTTT
CGATTTGA
back to top