Overview
NameMa01_t00520.2
Unique NameMa01_t00520.2
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length423
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:377594..383286 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
OriginRefSeq:rna1247
Old locus tagGSMUA_Achr1G09820_001
Old locus taggene915
Previous locationchr1:7490926..7496618
Notevesicle transport protein GOT1B, putative, expressed
Cross References
External references for this mRNA
DatabaseAccession
GeneID103981448
GenbankXM_009398188.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma01_g00520Ma01_g00520Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma01_p00520.2Ma01_p00520.2Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto1427004auto1427004Musa acuminataCDS
CDS-auto1427005auto1427005Musa acuminataCDS
CDS-auto1427006auto1427006Musa acuminataCDS
CDS-auto1427007auto1427007Musa acuminataCDS
CDS-auto1427008auto1427008Musa acuminataCDS
CDS-auto1427009auto1427009Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto1427010auto1427010Musa acuminataexon
exon-auto1427011auto1427011Musa acuminataexon
exon-auto1427012auto1427012Musa acuminataexon
exon-auto1427013auto1427013Musa acuminataexon
exon-auto1427014auto1427014Musa acuminataexon
exon-auto1427015auto1427015Musa acuminataexon
exon-auto1427016auto1427016Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma01_t00520.2 ID=Ma01_t00520.2|Name=Ma01_t00520.2|organism=Musa acuminata|type=mRNA|length=423bp
ATGGTTTCATTCGAGATGAATGATCGAAAAAAGATTGGGCTAGGCTTGAC
GGGTTTCGGTGTATTTTTCTCATTCTTGGGAATCATTTTCTTCTTTGACA
AGGGACTTTTAGCAATGGGGAATATTCTCTTCCTGTCAGGTCTAATGTTG
ACAATTGGTCTCAAGTCCACGATGCAGTTCTTCACCAAGCCTAAGAACTA
CAAGGGTACCATATCCTTTGGCGCTGGCTTCTTCCTGGTCCTGATTGGAT
GGCCAATCATTGGCATGATCGTGGAGTCATATGGCTTCATTGTCCTCTTC
AGCGGCTTTTGGCCAACCGTTGCAGTATTTTTACAGAGGATCCCCATCTT
TGGCTGGCTGTTCCAACAGCCTTTTGTGACATCGTTACTTGAGCGCTACA
GAGGCAAGCGAGTTCCAGTGTAG
back to top

protein sequence of Ma01_p00520.2

>Ma01_p00520.2 ID=Ma01_p00520.2|Name=Ma01_p00520.2|organism=Musa acuminata|type=polypeptide|length=141bp
MVSFEMNDRKKIGLGLTGFGVFFSFLGIIFFFDKGLLAMGNILFLSGLML
TIGLKSTMQFFTKPKNYKGTISFGAGFFLVLIGWPIIGMIVESYGFIVLF
SGFWPTVAVFLQRIPIFGWLFQQPFVTSLLERYRGKRVPV*
back to top

mRNA from alignment at chr01:377594..383286-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma01_t00520.2 ID=Ma01_t00520.2|Name=Ma01_t00520.2|organism=Musa acuminata|type=mRNA|length=5693bp|location=Sequence derived from alignment at chr01:377594..383286- (Musa acuminata)
GTAGTTCTTTCTGTCTCCTGTTCTTTCTCCGTCATCTCCCTCGCCGGTTT CCCTCTCCCCCTCTCTTTCTTCGTCTTCCTCTGTGGCTTTCGTGGCCGTT CCTCGGGTGCGTCTCTTTCTCTCCCACAGCAATTTCATTCGTTAGGATAA GCATAGGATCTTTGTGAGTTGATTTCTCGATTTGTTCCTCGGTCGCCCTT CCCTCTTTTTGGTGATCCACCCTCGTTTCGTTCTTGAGGATAGACATGGG ATCTCCGGACGTGGACATCTTGATTTCTTCTTTCCGTGGTTTGCCCTTAA CATGAGATCTCGTGCTGTTGATTTCTTGATTTCTTCTTCGATTTCCGATT TCAATTATTTTCTAGTCATTTACCCTGATTCCTGTATTGAGAACAAAGAC GGGAGCTCCAGGTGCTGATTCCTCGTTTTATGGATCAGTTCCCCAATTTT GTTTGAGTTGGTGGTGAATGAAGTACCTCTTCTGTGGATTTTGTGACGAT CGTTACAAGATTCTATTCCTTTTCCTGTGTTCTCTAACGATCTTTTATTA GGTTCGTCTGCGGTTTACCTTCCAGATTGAAGGGGTGATCACAGCCTGAT TCTTTCATCGAGGGAAGGTACTCCTGACGTCCAATAATCCAACTATGCGG CAAAAGTTGAAAACCCTAAATTTCTTTTCTTCTTTCCCTAATTTGTTTTT GCTGCTGGTAATAGTGCGTTACCACTCCCTGAATTGTTGTAGACAGAATT GATATCTAGTCAAATAACACGAAGCCTATATATTACCTGAACCAATTTTT TCTTCTTGCTTCTCTGGAAGGTCTCTTATATCAATTAATTCACTGGAAAA TGTTGTTCTTGTTGGTTTTTCCTCCATGATTCAGAGATATTCTCTAACTT TATAATCACACTACACTTGGCTCTATTCCTTCTGGTACTTCGCCTGATTC TTTCATCGCGGGAAGGTACTCCTGACATCCAATAATCCAGCTATGCAGCA AAAGTTGAAAACCCTAAATTGCTTTTCTTCTTTCCCTGATTTGATTGTGC TGCTGGTAATAGTGCGTTACCACTCCCTGAATTGTTGTAGACAGAACTAA TATCTTGGCAAATAACACGAAGCCTATACATTACCTGAACCTATTTTTGC TTCTTGCTTCTCTGTACGGTCTCTTATATCGGTAAAACCACTGCAAAATG TCGTTCTTGTTCTTTTTTTCTCCATGATTCAGAGATATTCTCAAACTTTA TAATCACACTACACTTGTCTCTAGTCCCTCTGTTACTTTTGGTTCTTGCC ACCACAATTTTCTCCATCTTGTAAATATAGGAGTCTTTTATAATTAGATC ATATGGAGTGTTATTAGCCCTTCGATTATTTGAGCCCTCCAGTTCATTAT CTTTTCGTATCCGAAAGCATTACACTTCCGATAGGACATGAGTGTAGATG AACTAGATAGCTAACCACGTAGGTCAATGTATACAAACTTACTGCAGAGA ACAGAATTATATGTTGACTGCTTTTATCCTAGATATACTTACTAGTTACC AATTCTAAACTAGACTTCTGCTTTTAATATGAGCTCTTCTTCTTTTTTCG GTTTTTTGATGTTAGCACTTATTTGCAGAACATCATGGCAGTTTGGAATT CTTTTTTAGTGTTAAATTTGGTGTGTTTTGGATGTATTGTTTCCATGGTC ATGGATGTCAATAGTAAGCAACGTGTGAAATGTGCACCATGTTGGATTTG CTATTTTGACTGCATGGTCTATTGCCTGTTTTGTGGCCTTGCATAAATGA ATTGTCCCAGGTTTTATCCAAAAGGTGCATAAAATTCTAATCACTAAGTA TTAACAACACATACAAAACTTACTGCATAAGTGAATGGTAGGTTGCTGTT GGTATATCATGTGAGGGAACAAGTAGGTCTTGAGGTATTTTATAATTACA TCACCCTGATACCTATATTTAAGAAATGTTAGCATGTCATCAGTAGGACA ATAAGATGTGCAGATAAAAGCATTCATGTTACATTTTAAATTTCTTAAGC TTCTTCCATGGGGACATAGGCAAAAATGAAATGCATTTTGCTACTTTTTG TATCCTAAATATCATGAATGGACTCCCTAAAACAATCATGTGTCTTAAAA TTATTGATGACATGTAGCCTAAGAGACCATCCATTCAGGATTACCAATTT GAGCTGGTCACTTCTTTCTTTTGCATGTCATAAGTTTTAGTTTTATTTCT TGTTACTTTGATGTTGATGAATTAAATAACTTGGTGTCAGCTCTTGCTTT TGCAGCTTTGTGTTCATTGGCTAGCTTGACACAATGGTTTCATTCGAGAT GAATGATCGAAAAAGTATGATCTCTCTGCCAAATGCATGTCAATTTTCCT TTACATGTTCCCATAAGGTAGATTAGAAGCATAAAACTGAAAGAAATATG AGACAATTCACTTTTTGATGTTTACCTTATACAGCTTATTACGAAATCTG TCATGTATTCTTAAGCAAGTATTTTATAATTAACATTTTGAGGTACAAGA ATAATTTAGTTAGTTTTCCTTCCCCTTTTTATCAATTTTTTAATTTTATT ATGCAATCATTCTTGTAAGATGGCATAGTGATGCAGGAATCACTTTTCTC TTATTTTGCTTCTTTTGCGGTTGGGGAGGTGGGGAGGAGTAGATTAAATT CATTTAATTCACTGGGATTCATTCACATCCCTGACTTCAACTAAATCTAT CAGGTGCTGGCATCTTGATTACTAGGTGCATGTACGGAGAGTTAAAAGGC TGACAACAATGAAGCAGGGAAATATTGAAATAAGGGTTTAAGAAGGATTT AAGTCCTTTTATGTTGCCAAAGCAGCACATCTGATCAATAAACCACCTGA TATGCAACTTCAAGGAAAATAAAAAAAAAGTATAAATGTGTATTTTGTAT AGGCAAACATTTACTCGAGATCGTTTACATTTAGTATTTCATACATGGAA GAGGCTTGTACATCACAATTTTTTGGAAGTGTGATGAAAGAAGATTTTGC ATTTTGATAGCAACTTAAAATTATTTGAGATGTGTATTTTGATTGATTGT AAAACAATGATTTAAAAAGCGCTAGGCGCCAAGGTCCAAAAACGCTCGAG GCGCTAGGCGCTCGCCCGAGCGAAGTGAGGCGCTAAAATATAAAAATATA TAATATAATTAATAAATATAATTATTTAAAATTTTAAATAAAAATATACT ATTAAATTAATCTAATAAATATAAATACTATTATTAGTATACAGTTAACA GTATACTGTATACTGTATACTGTTAACTGTATACTGCTAACAGTATACCA TCGAAGAGTGTAAGAGAAGAGTCGGAAGACCAAGGGTGTTGACCGAGAAG AGCGGGAGCGGCAGCTGCGAGTGACGACAGTGGCAGCGGCAGCAGCAGCG AGAGCGGGAGCGGCAAGCGGTGACAGTGGCACCGGCAGCTGCGAGCAGCG GGAGCGAGAGCGGAAGCGGCGAGCGGAGACAGTGGCAACGGTAGTAGCGA GCAACGGGAGCGGGAGGGGAAGTGGCGAGCGGAGACAGTGGCAATAGTAG CAGCGGCAGCGGGAGTGGGAGCGGCAACATTAGCAGCGAGCCGCGGCAGC AGCAGCGAGAGCGGCGAGTGGCGACAGCAGCAGCGGCGGCAATAGCGTGA ACGACGAGCAGGGTTAGGGTTGGGGAAGTCATGCTGATATCGGTGCTTTA GTTGGTTTGATTGAACCAACTAAAGCACCGGAGACCGAACCAGACCTCAA ACGCTGGTTCGGTCGCCTGGTTTAACCTAGGCGCTCACCCGAAGTGCCCG GTGCCTAGGCTCAGGTGATGTTTGATTACCATGTTTATGCTGCTTTGCTC TGCATCCTGAGATCTATTTCATGGTAGACCTTTTTTATTTAATAAGATTC TAGACATGTTGGCTGAAATTCAAATTCTCTGGTTATAGTGCTCCTCATAG ACTATAGTGCTCCTCATATTGGCTGAGGAGCACTATAGTCTAGACATGTT GGCTGAAATTCAAATTCTAGTAAGATTCACTTTGATTATAGTGCTCCTCA TAGACTAGCTTTGGTACCATCAATACTCTCTGGTTCTTCAGCAGCCATAA ATGGAACAGTTGTGAACGTAATCAAATATTTAACATATGTATCATTTAGG AATTTAATTCTTCACTAAGATCCTAGACATGTTGGTTGAAATTCAAATTA GAGTTTTTTTCTTTCTTGAAATTCAGTTACAAGGTCAGGTTGTAACATTT AGAGGTTGTTTTAACATTTCTGCTGCCACTTCTCTATGCAAGTGATTTGG CCCTTGTTCATTGACTAGTGCTGGTTATTGGCCTTTGCAGTCACTAGTAG ACAAGCAATCCGTGTTTCTTATGCCATACTTTATGTCTCCGTTCCGTAAC AAGGATTTACATTCAATTTCATTATTTATGATTTGTTATCTAGGTAGTCT GATGCCATTAGTGCTATTTTTTATGATCTCATTGTTCTAATATTCTAACC TTGAGTCTGTCTAATCAGAGATTGGGCTAGGCTTGACGGGTTTCGGTGTA TTTTTCTCATTCTTGGGAATCATTTTCTTCTTTGACAAGGGACTTTTAGC AATGGGGAATGTGAGTTCTTTTCGTATTCATCCTGTTTCACTGCATTAAA TGTTTTGGTCTTGCTTTTCCTATGAAATTAATGCATTTAACTGTTTGTTT TCTGGTTGCATATTCCTCAGATTCTCTTCCTGTCAGGTCTAATGTTGACA ATTGGTCTCAAGTCCACGATGCAGTTCTTCACCAAGCCTAAGAACTACAA GGTTTTACTCGTTGATATAGACTGGTCCACCATGCTGTATGGAGCTGTTT GATTAGGATCATTTCTTGCTTATTTGGCAGGGTACCATATCCTTTGGCGC TGGCTTCTTCCTGGTCCTGATTGGATGGCCAATCATTGGCATGATCGTGG AGTCATATGGCTTCATTGTCCTCTTCAGGTCAGTGCCTATTTGTTGGTAC AGAGGTTAATGTTTTTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTG TGGTCCGTTTGGCAAAAGGCTGTGTTTTGGAACGCATTACAAATGATGGC GTTATCATATTTGACATGTCAACTTCTTTGTATATTTAGCCACCTTAACT GAAGTTAGTGATTACTACTAATGTTGGTGTTTACCTTTGAAATTTCGATT GTGCTGATTGCTGACTTGGGTTAACTTCTCAGCGGCTTTTGGCCAACCGT TGCAGTATTTTTACAGAGGATCCCCATCTTTGGCTGGCTGTTCCAACAGC CTTTTGTGACATCGGTGAGAATGTGCGATCCAAATTTGTTGTAGGTAAAT TTGTAACATGTTAATTAAATTATGTCTGGCTACATCTGCAGTTACTTGAG CGCTACAGAGGCAAGCGAGTTCCAGTGTAGTAGCCGCCAGTCAACAAGCA GCTGCAGCAGCTGCTGCTGCTGTTATTAAGACAAGTTACTTCTCACTGCA AAAGTGTTACTTCTCACGGCGTATTGTTTGTAACAGGGGACTCTTTGAAT GATAGATAAGGTTGTATGTGCAGCTCGTGTCATCATGTTTATGTTTATTT GTGCCCGCTTTGGATCGTCTTATCTATCTATGCTTATGCATTT
back to top

Coding sequence (CDS) from alignment at chr01:377594..383286-

>Ma01_t00520.2 ID=Ma01_t00520.2|Name=Ma01_t00520.2|organism=Musa acuminata|type=CDS|length=423bp|location=Sequence derived from alignment at chr01:377594..383286- (Musa acuminata)
ATGGTTTCATTCGAGATGAATGATCGAAAAAAGATTGGGCTAGGCTTGAC
GGGTTTCGGTGTATTTTTCTCATTCTTGGGAATCATTTTCTTCTTTGACA
AGGGACTTTTAGCAATGGGGAATATTCTCTTCCTGTCAGGTCTAATGTTG
ACAATTGGTCTCAAGTCCACGATGCAGTTCTTCACCAAGCCTAAGAACTA
CAAGGGTACCATATCCTTTGGCGCTGGCTTCTTCCTGGTCCTGATTGGAT
GGCCAATCATTGGCATGATCGTGGAGTCATATGGCTTCATTGTCCTCTTC
AGCGGCTTTTGGCCAACCGTTGCAGTATTTTTACAGAGGATCCCCATCTT
TGGCTGGCTGTTCCAACAGCCTTTTGTGACATCGTTACTTGAGCGCTACA
GAGGCAAGCGAGTTCCAGTGTAG
back to top