Overview
NameMa01_t00460.1
Unique NameMa01_t00460.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length222
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:332511..333060 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
OriginRefSeq:rna1240
Previous locationchr1:7443742..7444291
NotePutative cold-regulated protein
Cross References
External references for this mRNA
DatabaseAccession
GeneID103981387
GenbankXM_009398110.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma01_g00460Ma01_g00460Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma01_p00460.1Ma01_p00460.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto1426884auto1426884Musa acuminataCDS
CDS-auto1426885auto1426885Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto1426886auto1426886Musa acuminataexon
exon-auto1426887auto1426887Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma01_t00460.1 ID=Ma01_t00460.1|Name=Ma01_t00460.1|organism=Musa acuminata|type=mRNA|length=222bp
ATGTCGACGACACAGGAAAAGACCAGCGCCGGCGCCACACAGACTCCGCC
CGCCGGAGGAGGAGGAGGAGGAGGGGTGAAGGAGACGAAAGTGGTGGAGA
CGACGGATTACCGGACGTCGGCCGGGCAAGGACAGCAAGAGCAGAGGCCG
GTGCAGGTGGTTCACGAGAACCCCACCGAAGGGAACGATGCCCGGGGCAA
AGCCGGCCAAAGAGAATTATAG
back to top

protein sequence of Ma01_p00460.1

>Ma01_p00460.1 ID=Ma01_p00460.1|Name=Ma01_p00460.1|organism=Musa acuminata|type=polypeptide|length=74bp
MSTTQEKTSAGATQTPPAGGGGGGGVKETKVVETTDYRTSAGQGQQEQRP
VQVVHENPTEGNDARGKAGQREL*
back to top

mRNA from alignment at chr01:332511..333060+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma01_t00460.1 ID=Ma01_t00460.1|Name=Ma01_t00460.1|organism=Musa acuminata|type=mRNA|length=550bp|location=Sequence derived from alignment at chr01:332511..333060+ (Musa acuminata)
TTCCCGTTCGTGGATCGAAATCTCCGTGGGAAGTCTCTCACTTCGGTCGA TGTCGACGACACAGGTATGCATGTGAAGTGGTGGTGGCTGTACGTACCTT CTTGTATCTGCTTTCCTCAGCCTGATCTTGTTGTTGCGTACGCACCGGTG AAGGAAAAGACCAGCGCCGGCGCCACACAGACTCCGCCCGCCGGAGGAGG AGGAGGAGGAGGGGTGAAGGAGACGAAAGTGGTGGAGACGACGGATTACC GGACGTCGGCCGGGCAAGGACAGCAAGAGCAGAGGCCGGTGCAGGTGGTT CACGAGAACCCCACCGAAGGGAACGATGCCCGGGGCAAAGCCGGCCAAAG AGAATTATAGTTCCCGAGGAGGCCAACACATCGTGTACATATGTCCCGAC CCGATGCAATAATATGATGCGATGGCTCTTTGCTTTGCGATCGACGAATG AATCGAATATGTGATCTTGACCTTTCTATTTATATTTCCAGCAGAATGAT ATGTACTACGGAGCGAGAAAATCCAATCTCGTGATGCTATGAGCAAGAAA
back to top

Coding sequence (CDS) from alignment at chr01:332511..333060+

>Ma01_t00460.1 ID=Ma01_t00460.1|Name=Ma01_t00460.1|organism=Musa acuminata|type=CDS|length=222bp|location=Sequence derived from alignment at chr01:332511..333060+ (Musa acuminata)
ATGTCGACGACACAGGAAAAGACCAGCGCCGGCGCCACACAGACTCCGCC
CGCCGGAGGAGGAGGAGGAGGAGGGGTGAAGGAGACGAAAGTGGTGGAGA
CGACGGATTACCGGACGTCGGCCGGGCAAGGACAGCAAGAGCAGAGGCCG
GTGCAGGTGGTTCACGAGAACCCCACCGAAGGGAACGATGCCCGGGGCAA
AGCCGGCCAAAGAGAATTATAG
back to top