Overview
NameMa01_p01620.1
Unique NameMa01_p01620.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length619
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1124825..1128572 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa01_g01620~ Protein NRT1/ PTR FAMILY 7.3~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103980435
GenbankXM_009396861.1
InterProIPR020846
InterProIPR000109
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01620.1Ma01_t01620.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01620.1 ID=Ma01_p01620.1|Name=Ma01_p01620.1|organism=Musa acuminata|type=polypeptide|length=620bp
MASSERSKMEKEERAIEVGAVKSRSDSLNKDVNGEKDERYEYTLDGSVDA
RGRPAAKGKTGGWVAGALLLVNQGLATLAFFGVGVNLVLFLTRVLQQNNA
DAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLGLLSL
STYLFLLKPSGCGQEHLLCGPHSSMELGVFYLSVYLIALGNGGYQPNIAT
FGADQFDEEDRSEAHSKVSFFSYFYLALNLGSLFSNTFLGYFEDKGMWAL
GFWASAGSALVALVLFLCGTPRYRHFRPVGNPLSRVCQVVIAASRKWRLH
IPLGGYDLYEVEAKEVSAVAGSRKILHTHGFKFLDRAAIVDPGNDFVIRE
DMSSARDPWRLCPITQVEELKCVLRLLPIWLTTIIYSVVFTQMASLFVEQ
GAAMNTTVAGFRIPPASMSAFDIVSVALFIFFYRRLLSPLVSRLRRNPRG
LTELQRMGVGLVIAVLAMISAGTVEVYRLKHVCSGCDDDSSLSILWQIPQ
YMLIGASEVFMYVGQLEFFNSQAPDGLKSFGSALCMTSISFGNYVSSLLV
TIVMEITARGERPGWIPVNLNKGHMDRFYFLLASLTAADLVAFVACARWY
KCIKLEGRHDDDDKENSNV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Protein NRT1/ PTR FAMILY 7.3Protein NRT1/ PTR FAMILY 7.3
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005215transporter activity
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane