Overview
NameMa01_p01540.1
Unique NameMa01_p01540.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length191
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1060391..1062540 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T06220_001
Old locus tagGSMUA_Achr1G06220_001
Color6
NoteMa01_g01540~ abhydrolase domain-containing protein FAM108C1, putative, expressed~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9FVR4
TrEMBLQ84SE0
TrEMBLD7TTQ7
TrEMBLD7KHH0
TrEMBLC5YHD9
TrEMBLB9RZ23
TrEMBLA3BPW0
TrEMBLA2YRG8
TIGROs12g18860.1
TIGROs08g06420.2
TIGROs08g06420.1
TIGROs06g42730.1
TIGROs02g55330.2
TIGROs02g55330.1
TIGROs02g09770.1
TIGROs01g49510.1
SwissProtQ96GS6
SwissProtQ7M759
SwissProtQ6DEY3
SwissProtQ6DCC5
SwissProtQ6AY17
SwissProtQ5ZJ01
SwissProtQ5XIJ5
SwissProtQ5VST6
GreenPhylGP000202
InterProIPR029058
InterProIPR029059
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01540.1Ma01_t01540.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01540.1 ID=Ma01_p01540.1|Name=Ma01_p01540.1|organism=Musa acuminata|type=polypeptide|length=192bp
MANLSLAVPHCVWQLPRLRGIVLHSAILSGLRVVCHVKFSFCFVIYKNID
KMKKVKCPVFVIHGTEDDVVNWLHGHGLWKLAEEPYDPLWIKGGGHCNLE
LYPDYIRHLCKFIREMENLTTATRLKKIRQTLKLPAKAAATTSTTTFTTN
CCCQIRCRKPDCWSCPRRGCLMVRCSKGSAYLCNWCCGDWH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
abhydrolase domain-containing protein FAM108C1, putative, expressedabhydrolase domain-containing protein FAM108C1, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene