Overview
NameMa01_p01530.1
Unique NameMa01_p01530.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length368
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1054994..1056433 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T06230_001
Old locus tagGSMUA_Achr1G06230_001
Color6
NoteMa01_g01530~ Transmembrane 9 superfamily member 3~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ8H012
TrEMBLQ84LF6
TrEMBLC5WRM4
TrEMBLC0P6V5
TrEMBLB9FZ73
TrEMBLB6TZ24
TrEMBLB6T9C2
TrEMBLB6T1Z7
TIGROs12g07670.1
TIGROs11g07910.1
TIGROs10g02350.1
TIGROs09g38530.1
TIGROs08g06470.2
TIGROs06g37160.1
TIGROs03g13380.1
TIGROs02g34690.1
SwissProtQ9DBU0
SwissProtQ66HF2
SwissProtQ5R8Y6
SwissProtQ5R8F1
SwissProtQ54ZW0
SwissProtP58021
SwissProtO15321
SwissProtA4IFE9
InterProIPR004240
GreenPhylGP000292
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01530.1Ma01_t01530.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01530.1 ID=Ma01_p01530.1|Name=Ma01_p01530.1|organism=Musa acuminata|type=polypeptide|length=369bp
MYYDDLPLWGFLGKIEGVKTDSGKDKYFLFKHIHFNILYNDDRVIEINVQ
TDPNINLDISEDRKLDVEFLYSIHWFSIVNSCVTVLLLTGFLATILMRVL
KNDFVKYSLIEESLEDQEDSGWKYIHGDVFRFPKNKSLFSVIIGSGTQLL
VLTMFIFLLALVGVFYPYNRGALYTALVVIYALTSGIAGYTASSFYMQLK
GTNWVRNLLLTGCLFCGPLFLTFFFLNTVAITYSATAALPFGTILVILLI
WALVTSPLLILCGVTGKNSKIEFQAPCSTNKYPREIPELAWYRGTIPQMA
MAGFLPFSAIYVQVELYYIFARVWGHNIYTIYSMLFIVFIILIIGTAFIT
VALTYFQLAAKDHGWWWR*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Transmembrane 9 superfamily member 3Transmembrane 9 superfamily member 3
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene