Overview
NameMa01_p01520.1
Unique NameMa01_p01520.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length140
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1052507..1054525 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T10850_001
Old locus tagGSMUA_Achr1G10850_001
Color6
NoteMa01_g01520~ Transmembrane 9 superfamily member 3~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ84LF6
TrEMBLQ7G5M7
TrEMBLB9S7D0
TrEMBLB9P5I5
TrEMBLB9H3J8
TrEMBLB9FZ73
TrEMBLB8BAY0
TrEMBLB6T1Z7
TIGROs12g07670.1
TIGROs11g07910.1
TIGROs10g02350.1
TIGROs09g38530.1
TIGROs06g44140.1
TIGROs06g37160.1
TIGROs03g13380.1
TIGROs02g34690.1
SwissProtQ9DBU0
SwissProtQ8BH24
SwissProtQ66HF2
SwissProtQ5R8F1
SwissProtQ54ZW0
SwissProtQ4KLL4
SwissProtO15321
SwissProtA4IFE9
InterProIPR004240
GreenPhylGP000292
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01520.1Ma01_t01520.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01520.1 ID=Ma01_p01520.1|Name=Ma01_p01520.1|organism=Musa acuminata|type=polypeptide|length=141bp
MAMAGFLPFSAIYVELYYIFASVWGHKIYTIYSILFIVFIILIIVTAFIT
VALTYFQLAAEDHGWWWRSVLCGGSTGVFIFFYCIYYYHARSDMSGFMQT
SFFFGYMTCICYGFFLMLGTVGFRASLLFVRHIYRSIKCE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Transmembrane 9 superfamily member 3Transmembrane 9 superfamily member 3
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene