Overview
NameMa01_p01510.1
Unique NameMa01_p01510.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length65
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1050084..1051556 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T10840_001
Old locus tagGSMUA_Achr1G10840_001
Color6
NoteMa01_g01510~ OsFBDUF18 - F-box and DUF domain containing protein, expressed~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ10BX1
TrEMBLD7T5D4
TrEMBLD5ABE5
TrEMBLC5XBZ4
TrEMBLB9SMJ5
TrEMBLB9N336
TrEMBLB9I514
TrEMBLA9PIG2
TIGROs12g27050.1
TIGROs12g12690.1
TIGROs09g10274.1
TIGROs03g58764.1
TIGROs01g57004.1
SwissProtQ8LCL8
SwissProtQ00202
GreenPhylGP003578
InterProIPR028144
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01510.1Ma01_t01510.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01510.1 ID=Ma01_p01510.1|Name=Ma01_p01510.1|organism=Musa acuminata|type=polypeptide|length=66bp
MQDPKYAYPYPAQGYYHGPPVMAPPQYAAAPPRRSSGFLEGCLAALCCCF
LIDECCCDPSILFIC*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
OsFBDUF18 - F-box and DUF domain containing protein, expressedOsFBDUF18 - F-box and DUF domain containing protein, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene