Overview
NameMa01_p01490.1
Unique NameMa01_p01490.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length298
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1032603..1035293 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa01_g01490~ E3 ubiquitin-protein ligase SINAT2~ unknown_gene~ complete
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01490.1Ma01_t01490.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01490.1 ID=Ma01_p01490.1|Name=Ma01_p01490.1|organism=Musa acuminata|type=polypeptide|length=299bp
MDVPESYPTETEFSTVGMETDRVPSYKSSAASGAKAGISSTGSVHELLEC
PVCTNSMYPPIHQCPNGHTLCSSCKLRVHNHCPTCRQELGNIRCLALEKV
AESLELPCRYQNLGCLEIHPYYSKLKHEQLCRFRPYNCPYAGSECLVTGD
VPMLVAHLKTDHKVDMHDGCTFNHRYVKPNPNEVENATWMLTVFSCYGHY
FCLHFEAFLLGMAPVYMAFLRFLGEDSEARHFSYSLEVGGNGRKLTWQGV
PRSIRDSHRKVRDSYDGLIIHRNMALFFSGGDRHELKLRITGRIWKEQ*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
E3 ubiquitin-protein ligase SINAT2E3 ubiquitin-protein ligase SINAT2
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein ligase activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0016567protein ubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
GO:0007275multicellular organismal development
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus