Overview
NameMa01_p01430.1
Unique NameMa01_p01430.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length456
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:1003725..1005095 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa01_g01430~ Hypothetical protein~ unknown_gene~ missing_functional_completeness
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103982574
GenbankXM_009399543.1
InterProIPR003441
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01430.1Ma01_t01430.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01430.1 ID=Ma01_p01430.1|Name=Ma01_p01430.1|organism=Musa acuminata|type=polypeptide|length=457bp
MEPIDLVPSGYRFLPTAEELLVDYLANWVAGAPLPGRAVAFADVYGTEPW
NLLGSDRQEGYFFAERKPKNSGGSRVDRKAGSGSWTLYKKQETVKSMVGG
REMVVGRKSCLSFNDGRRKNSGWTMYEFEMCSSGGFERRVLCHVKRSSHC
AYSGGTTIKTVETTLTEAATDTVTGDSFVGRKRNRDESSTLSAKASTLSK
KPCWELVAHPGRALQSDVSPHPTAVVQSDVSPPPTAVVQHPSLAPAVTPP
PPESHLSSVDSVAPNEAGVAAASPSSTDVGGGELPITTEELEAFLASSSS
SVDLGGEQNCTDDAFFAREVEAFLMSDDTDTALTTIPKASPPGFVDLLSM
PDDTRIDSTTVADVSSSSSSIDFVACEHMHSTDDDFFASLERVYASLMSD
DTIPASVMYGTSTDLTTVAAASSSSSIDIVGCEQTEIIDDNYDFPIDSTM
AWWLDL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
missing_functional_completenessmissing_functional_completeness
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_5IC_5
Vocabulary: Genedb Products
TermDefinition
Hypothetical proteinHypothetical protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated