Overview
NameMa01_p01350.1
Unique NameMa01_p01350.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length688
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:950504..952572 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa01_g01350~ Putative Protein FAR1-RELATED SEQUENCE 5~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103982289
GenbankXM_009399183.1
InterProIPR004330
InterProIPR018289
InterProIPR007527
InterProIPR006564
InterProIPR031052
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01350.1Ma01_t01350.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01350.1 ID=Ma01_p01350.1|Name=Ma01_p01350.1|organism=Musa acuminata|type=polypeptide|length=689bp
MEGTLSEDDGLIRDSSMDLNDSTSDPHMALALGALGIELNLDGPDIGEPC
IGMEFDSDEAAKEYYISYANRVGFGVRMNKSRRSRKDDTVIMRRFVCTRE
GFHSKRVIYDDGKKKRKRGTTREGCMAMIEVIRKDHGKWVVTKLITEHTH
MVAFPGKVQPRVDNSIIQNSSGLLHATSSGGFGNLKNFNRGIRVNPFGEG
GEAEGLLEYLKKMQAENPAFFYAIQVDNNNCMTNVFWADAKARMAYQYFG
DAVTFDTTYKKTKYMMPFATFRGVNNHLQSVTFGCALLMDETKGSYVWLF
ETWLSAMGGHHPDTLVTDRDKAMEGAITRVFPNARHWFCNWHILSRCKQR
LSDVYLKYATLKRDLKECINHSETVEEFDTRWELILDKYNLWDNPWLQSL
YDVRQRWAPAYQKGTFFPELSASQRSESLNKFFKRNFNSKTSLLVFIARF
DQEMASQYEKEAQADFAAAYTKPLLRTPSPIEKQAAEVYTKEIFDKFQEE
FIESLGYYVDKIEDGPNNKYNVTKEEDNRRAYIVIFSEPEKKASCSCYKF
ESSGILCRHILRVFFIVGIRVLPEYYILKRWTRDAASSVILDERATEPGL
NFQDCLVAWYNDLCLDAVKYGIEGAMSSEIYKVAKAALQKALAEVVAAKN
TQRKGQQNMQRFARLQKMQYKMPLPKLQTKKTPARSTQD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative Protein FAR1-RELATED SEQUENCE 5Putative Protein FAR1-RELATED SEQUENCE 5
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated