Overview
NameMa01_p01320.1
Unique NameMa01_p01320.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length656
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:932870..936021 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Owneracenci
Annotator commentremoved three exons and other modifications; added five prime and three prime UTRs
OriginCIRAD:GSMUA_Achr1T10650_001
Old locus tagGSMUA_Achr1G10650_001
Color2
NoteMa01_g01320~ ABC transporter G family member 14~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ2V607
TrEMBLD7TFB5
TrEMBLD7KGM2
TrEMBLC5YHG8
TrEMBLB9S1S7
TrEMBLB9N0R0
TrEMBLB9GVQ0
TrEMBLA5C7D5
TIGROs11g07600.1
TIGROs09g23640.1
TIGROs08g07010.1
TIGROs06g40550.1
TIGROs05g13520.1
TIGROs04g44610.1
TIGROs03g17370.1
TIGROs03g06139.1
SwissProtQ9SZR9
SwissProtQ9LK50
SwissProtQ9FT51
SwissProtQ9C6W5
SwissProtQ93YS4
SwissProtQ84TH5
SwissProtQ7XA72
SwissProtQ7TMS5
InterProIPR017871
InterProIPR013525
InterProIPR003593
InterProIPR003439
GreenPhylGP000103
InterProIPR027417
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t01320.1Ma01_t01320.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p01320.1 ID=Ma01_p01320.1|Name=Ma01_p01320.1|organism=Musa acuminata|type=polypeptide|length=657bp
MTPHQAEPETGGGHNMDQTTVNSTVVPYPTGTAHPGPRPPQAAAVFPITL
KFEEVVYKVKVGGGGWWRRSSSPAEKTILNGITGVVCPGEMLAMLGPSGS
GKTTLLTALGGRLGGKLSGKITYNGHPFSGAIKRRTGFVAQDDVLYPHLT
VTETLTFTALLRLPGTLTRAEKAHQAQQVISELGLSRVAHSMIGGARGVR
GVSGGERKRVSIGLELLVDPSLLLLDEPTSGLDSTTAARIVGTLKRLAAE
KGRTVVTTIHQPSSRLYRMFDKLVLLSEGSAIYYGRAAAAVDYFAMVGFA
SPIDGVNPADLLLDLANGIAPESNYASENGDGSGGLQQEKKAVKEALIGA
YDRNIATRLKAELCAVDLNNYGYTREMANAMKREQWCTSWWEQFTVLLSR
GLKERRHEAFNKLRIFQVLSVATLGGLLWWHTPTSHIQDRTALIFFFSVF
WGFFPLYNAVFTFPQERPMLRKEQASGMYRLSSYFLARTAGDLPMELALP
TAFTFIIYWMGGLRSDPVAFLLSLLVVLFSVLVAQSLGLAVGAILMDVKQ
ATTLASVTTLVFLMAGGYYVQQIPPFVVWLKYLSYSFYCYKLLLGVQFSE
HDAYECSSGVMCPVIDYPAIKSVGLGHIWIDVCIMGLMLVGYRLVAYLAL
HHLQSG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0017111nucleoside-triphosphatase activity
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
ABC transporter G family member 14ABC transporter G family member 14
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene