Overview
NameMa01_p00550.1
Unique NameMa01_p00550.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length719
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:392829..404389 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa01_g00550~ phox domain-containing protein, putative, expressed~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103981485
GenbankXM_009398239.1
InterProIPR001683
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t00550.1Ma01_t00550.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p00550.1 ID=Ma01_p00550.1|Name=Ma01_p00550.1|organism=Musa acuminata|type=polypeptide|length=720bp
MAKNSPPKHRHDGTSPLPLGMDWSPPPKRWDGRNTIWPHDPQTGWSYCVM
IPSWIVQTEPGGTHESFLNPIVFYRIHVGIQSPEGISTSHGLLRRFSDFL
KLYSALKKTFPRRDIPAAPPKHAFLRINASRMLLEERRRALEEWMGKLLS
DIEFSRSALVAGFLELEVAARSAFQYVNNHPTEPSSTDSTAAPSLIPARP
SSSASVADCSKIPSKSHTVAAKSPSMPSDICSDNADETSDLETPRKGKIR
EFNTSTEDLTFHDVNNGILGESFLDQPEDFIKTKLNQRRGYLVSERDMTG
GSTFRDRVESISSDHDHDKLYGHARRLSSESIGSDISSIRGSELSFTGAT
NSLWDGSLDVPVGAEISNAMDAFAGLGTQSLDNAQIVLPIDQRHKLNRVL
LTMQRRLGTAKTDMEDLIARLNQEMAVKEYLTTKVKDLEVELEATEQKGK
ENLQQAVFIERERVTQMQWDMDELRRKCSEMESKLKLEQELGSKQEELLN
MRKHLEEQESKSKADIKVLVKEVKFLRKSQAELKELMNQTLKEKSELEGF
LHKEKQKWSNAKSASKNLLHECRVLRDRLQECSVNFLADEEDKFTISPSS
LSDALDLLATSDNRIGLLLAEAQLLARNDEEACIDDDDAQTSEFSGSGIA
SNGDNPMRADDNDDEMRNILTDMFIDNARLRKQVNSVIRCALNTVIKPER
EESNEVSSRKTVLNRFLER*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
phox domain-containing protein, putative, expressedphox domain-containing protein, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0035091phosphatidylinositol binding