Overview
NameMa01_p00510.1
Unique NameMa01_p00510.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length1037
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:359631..377210 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa01_g00510~ Kinesin-like protein BC2~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103981439
GenbankXM_009398171.1
InterProIPR001752
InterProIPR027640
InterProIPR019821
InterProIPR027417
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t00510.1Ma01_t00510.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p00510.1 ID=Ma01_p00510.1|Name=Ma01_p00510.1|organism=Musa acuminata|type=polypeptide|length=1038bp
MENGEHCCVKVAVHIRPLVGDERLQNCKECVTVVPGKPQVQIGTHSFTFD
HVYGGTGSPTSAMFEECVASLVDGLFQGYNATVLAYGQTGSGKTYTMGTG
CRDGSHTGIIPLVMNALFSKIDALKHQVEFQLRVSFIEILKEEVRDLLDS
ATVGKLEACNGQVGKAAIPGKPPVHIREGSNGVITLSGSTEIDVSTRKEM
TGCLEQGSSNRATGSTNMNNQSSRSHAIFTITLEQMRKLGPISTADSAPI
GDITDDYLCAKLHLVDLAGSERAKRTGSDGLRFKEGVHINKGLLALGNVI
SALGDEKKRKEGAHVPYRDSKLTRLLQDSLGGNSRTVMIACISPADINAE
ETLNTLKYANRARNIENKPIVNRNPISDEILRMHQHIEYLQAELACSRGV
GTESDEVQTLKERISWLEATNEDLCRKLCEYHGQQASEHFERDFQKGRTC
FVKAEGLKRSLQSTESLHFQLAKNLGGDSLKEFDEEIAKEWEYEMLQDSM
GKELNELNRQLEQKESEMKTFGGCDTLVLKQHFGKKLMEFEEEKRTVQQE
RDRLLSEVENLSANSDGQMHKLPDDYLQKLKTLEAQIINLKKKQENQVQL
LKQKQRSDEAAKKLQDEIQFIKAQKVQLQHKIKQEAEQFRQWKASREKEL
LQLRKEGRRNEYERRKLQALNQRQKMVLQRKTEEAAMATKKLKELLEARK
SSARENPVIAIGNSAIIQINEKSLQQWLDHEVEVLVHMHEVRDEYEKQCQ
MRSTLAEELSFFKQEEALSGSASPPRGKNGSSRLSSMTPNARLARIASLE
NMVTISSNTLIAMASQLSEAEEREHTFAGRGRWNQLRSIGDAKCLLQYMF
NVAADARCQLREKELHIKELKEQLNELIGLLRHSEAQRKEMEKEQKLREH
AIAIALATSSPMNSNGSLKHCIDETGTPLSPIAVPAQKQLKYTAGIVSSP
GNGTAAFNNHPMKKMVPIGHLSMGKKLAVIAQGGKLWRWKRSHHQWLLQF
KWKWQKPWRLSEWIRHSDETLTRATRPRTHHPLRNIM*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Kinesin-like protein BC2Kinesin-like protein BC2
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
Vocabulary: Biological Process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: Cellular Component
TermDefinition
GO:0005871kinesin complex