Overview
NameMa01_p00490.2
Unique NameMa01_p00490.2
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length150
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr01chromosomechr01:342486..345468 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa01_g00490~ Protein RER1A~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103981413
GenbankXM_009398152.1
InterProIPR004932
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma01_t00490.2Ma01_t00490.2Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma01_p00490.2 ID=Ma01_p00490.2|Name=Ma01_p00490.2|organism=Musa acuminata|type=polypeptide|length=151bp
MMDPSSGGGGGEGGGSSFLSAWVAAASRRHQHLLDKATPHVRRRWAWLGV
LALVYTVRVWIAQGFYIVSYALGIYLLNLFIAFLSPQVDPEIHEVVDGGP
GPSLPTRSSDEFRPFVRRLPEFKFCYNEKTDSSHDQIQICSIHLRKAALH
*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Protein RER1AProtein RER1A
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane