Overview
NameMa00_t05370.1
Unique NameMa00_t05370.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length168
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:46147776..46148111 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
OriginCIRAD:GSMUA_AchrUn_randomT27660_001
Old locus tagGSMUA_AchrUn_randomG27660_001
NoteUncharacterized protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g05370Ma00_g05370Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p05370.1Ma00_p05370.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2013248auto2013248Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2013249auto2013249Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t05370.1 ID=Ma00_t05370.1|Name=Ma00_t05370.1|organism=Musa acuminata|type=mRNA|length=168bp
ATGGACGCTGGCAGCGTTGTCTCCTGGCCGGGGAACATCGGCGGCGGTGG
TCGCCGGTCGGGAAGAGGGGCGTTGGTGGGCGCTGGCCGGAGAGCAGCAG
CGGCAGGTGGGGTGGCTGCAGCTTCTTCTTCCTCTCGTGTTTCTTCTTTT
TTTTTTTTTTTTGAATGA
back to top

protein sequence of Ma00_p05370.1

>Ma00_p05370.1 ID=Ma00_p05370.1|Name=Ma00_p05370.1|organism=Musa acuminata|type=polypeptide|length=56bp
MDAGSVVSWPGNIGGGGRRSGRGALVGAGRRAAAAGGVAAASSSSRVSSF
FFFFE*
back to top

mRNA from alignment at chrUn_random:46147776..46148111-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t05370.1 ID=Ma00_t05370.1|Name=Ma00_t05370.1|organism=Musa acuminata|type=mRNA|length=336bp|location=Sequence derived from alignment at chrUn_random:46147776..46148111- (Musa acuminata)
ATGGACGCTGGCAGCGTTGTCTCCTGGCCGGGGAACATCGGCGGCGGTGG TCGCCGGTCGGGAAGAGGGGCGTTGGTGGGCGCTGGCCGGAGAGCAGCAG CGGCAGGTGGGGTGGCTGCAGCTTCTTCTTCCTCTCGTGTTTCTTCTTTT TTTTTTTTTTTTGAATGAGATGGGGCAGCGAGGAGGTCGAGCGGTGGTCG AAGGTCGCTGGCCGGGGAAAGAGCGACAACGGTAAGGCTACGGCGGGGTG CACCAATGATCGTTGCTCTGATACCAAATGATAAGACCCTAAAGGTCTTA TCGTAGGCTCTGATACCAAATGATAAGACCCTAAAA
back to top

Coding sequence (CDS) from alignment at chrUn_random:46147776..46148111-

>Ma00_t05370.1 ID=Ma00_t05370.1|Name=Ma00_t05370.1|organism=Musa acuminata|type=CDS|length=168bp|location=Sequence derived from alignment at chrUn_random:46147776..46148111- (Musa acuminata)
ATGGACGCTGGCAGCGTTGTCTCCTGGCCGGGGAACATCGGCGGCGGTGG
TCGCCGGTCGGGAAGAGGGGCGTTGGTGGGCGCTGGCCGGAGAGCAGCAG
CGGCAGGTGGGGTGGCTGCAGCTTCTTCTTCCTCTCGTGTTTCTTCTTTT
TTTTTTTTTTTTGAATGA
back to top