Overview
NameMa00_t04120.1
Unique NameMa00_t04120.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length510
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:35361837..35369139 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
OriginRefSeq:rna44266
Old locus tagGSMUA_AchrUn_randomG20800_001
Old locus tagGSMUA_AchrUn_randomG20810_001
Old locus taggene32858
Previous locationchrUn_random:100802814..100810116
NoteUncharacterized protein
Cross References
External references for this mRNA
DatabaseAccession
GeneID103974631
GenbankXM_009389497.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g04120Ma00_g04120Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p04120.1Ma00_p04120.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2012096auto2012096Musa acuminataCDS
CDS-auto2012097auto2012097Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2012098auto2012098Musa acuminataexon
exon-auto2012099auto2012099Musa acuminataexon
exon-auto2012100auto2012100Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t04120.1 ID=Ma00_t04120.1|Name=Ma00_t04120.1|organism=Musa acuminata|type=mRNA|length=510bp
ATGTCGCCCACTCTCGTCTCGCTATCCATCGTAAACCCTACAGCCTTTGC
CGCCCGCAAATCCTCCCTCTTCCCCGGCGTCCGCCCTCTTCCCCCGCTCC
TGCCCTCTCGCCTCCAAACCCCAGCGGCCTTGCGGGGGTTCAGGAGGCGG
CGGCGCGGGTGGGGAGCGCTGGTTCCGCCCTCGGCGGCCGCGTCGGCGTT
CTCGGCGGCGGCTGAGGATGAGGAGTGGCTCAAGAAGCTCCCTGACAAGA
AGAAGCCTCTCTACTCCCACAGCCTCCCGTGCATCGAGGCGTGGTTCAGA
AAGCTTGGGTTCCGACAGAGCCGGGATGATCGAGCGGTGTGGGTCGTCGA
GAAACCCAACTGGCACGCCCAGCTCTCCCTCGATGTCACCGACCTTTACA
TAAGGTACCTGAAGAGTGGGCCAGGAAACCTTGAGAAGGACATTGAGAGA
AGATTTAGTTATGCGTTGAGCAGGGAGGATATTGAAAATGCCATCCTTGG
TGGACCTTGA
back to top

protein sequence of Ma00_p04120.1

>Ma00_p04120.1 ID=Ma00_p04120.1|Name=Ma00_p04120.1|organism=Musa acuminata|type=polypeptide|length=170bp
MSPTLVSLSIVNPTAFAARKSSLFPGVRPLPPLLPSRLQTPAALRGFRRR
RRGWGALVPPSAAASAFSAAAEDEEWLKKLPDKKKPLYSHSLPCIEAWFR
KLGFRQSRDDRAVWVVEKPNWHAQLSLDVTDLYIRYLKSGPGNLEKDIER
RFSYALSREDIENAILGGP*
back to top

mRNA from alignment at chrUn_random:35361837..35369139+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t04120.1 ID=Ma00_t04120.1|Name=Ma00_t04120.1|organism=Musa acuminata|type=mRNA|length=7303bp|location=Sequence derived from alignment at chrUn_random:35361837..35369139+ (Musa acuminata)
TCCACGCTCTCTCCTCCTCGTCGCCGGCTAATGCTATCCGACCAATCACA ATGTCGCCCACTCTCGTCTCGCTATCCATCGTAAACCCTACAGCCTTTGC CGCCCGCAAATCCTCCCTCTTCCCCGGCGTCCGCCCTCTTCCCCCGCTCC TGCCCTCTCGCCTCCAAACCCCAGCGGCCTTGCGGGGGTTCAGGAGGCGG CGGCGCGGGTGGGGAGCGCTGGTTCCGCCCTCGGCGGCCGCGTCGGCGTT CTCGGCGGCGGCTGAGGATGAGGAGTGGCTCAAGAAGCTCCCTGACAAGA AGAAGCCTCTCTACTCCCACAGCCTCCCGTGCATCGAGGCGTGGTTCAGA AAGCTTGGGTTCCGACAGAGCCGGGATGATCGAGCGGTGTGGGTCGTCGA GAAACCCAACTGGCACGCCCAGCTCTCCCTCGATGTCACCGACCTTTACA TAAGGTCAGTGCTTTCGCGAACCTTTCCACTTATGTTGCCGTCGTTGTTC TTGCGCGTTCGGTGTTCTTGGACACCTAAGGTCGCAAGAATTGATTGAAT TGCTAAGAGATTTGTGGTTTTGCTGTACCGCAAAATGTTAGAATATTTTT CCCTGTAATTCCATAAAGATATTTTCTTTAAATACATCTATGCGGCGAAC AACATTATATTCAAGGCAGCCATAGCGATTTTGGCCACTCAATTCATTTC CATAACTGCCTCATCATCTGTCCACATGGTATTTGATAGAATGACCATAG TGATTTTTTTTTTTTTTTTTTGGATGATAAAGTTGGTCATGATGCAAAGG TCATCCACCATGAAATTTAGATACCTACTAGATTTTTGTCTTTTAATATT AATACTGTTGGAGTGGGAAAGTGTCACATTAGTATGTTCATGTACGTTAA TGGGAAGGTGCTATATGCACAAAATGATTAAGGTTTTGAAGAGGAAATAA AGAGGTTAATAGAATTGTAGATGGCCAATGTCTTATGCTAAAAAGAGTTT CATGGATGATCATATAATGTAACTTGAATTTGTTTGTAAACATTAGTAAA ATTTGAAACCACACGTATGATTGAAGACCTGCCAAAGCTAAAAAGGATTT TAGAACTTGCATGAGGGGTCTTCATATTGCATGTATCTACATTTCTAGGT GTGATCTTCTGGCCTAATGTTACTCTCAAACATCTAAGTGTGACTTTAGT TTAAGGGAGTGGGATGACAATCTTTGCTCACTCTTGTGATATTTACTTTC TGCTCTGAAATCCTTGCATATCAAGCTGAAGGGTGATGGAGAACAATCTC CCTTAAGTAGTTTTATTTAGATCGATTTGTTAGCGGAGGCAAGAAACATT TGTGACTTACAAATGAAAATCATGCATTTTTCCTTTTTCACAAGAAAAGA AAAAGGAAGCAATTTATATCTTGTTTACCTGAAAGTTACGGAAGTCAGCT ATGATTGGTGACAGAAATCAATAAACTGGGTACTGGCATTGGATGGCATC CTGTGGTGTTATCTAATGAGTATTTCGATGGCTCCTAGCTAAAGGTGACA TTTTACACAATTTTGATAAGTGACATTGCTGAGTCATATATTTTGTAATT TGATTCAGGTTCTGAAATAATCTACATTGTAAGTTGATGTATGTCTAGCC TTTTCGTTTTTTTTTTGCATTTTCATAGATTTTTCGCATTTATATATGTT TGCCGAGTTGTCACGGACTTAGCTGGTTTTACTTAAGTCATGCGGCACCC TTGCTTGTCCGTCCGTAAAGGTCAGCCTCCCCGAAACCTCTCATGGTTCC TTAGGACCTACAAAAGAGAAAACGGGTTAGAGAAAGTGCCTCACTCGGGA TCCACAAGCAAATATTTTAGGAAACACTTCATAGACAATGCAAATTACAA ACAGACTTTACAAGCTCTAAACAGTTGTACAACAAAGGGTCAAAATGATC CACTACAGACCGAATATCTCTCACACGTGTCTACATGACACAACCTTTAT TTACAAGCCTAAAAAGGCCACCAAACCCAACTAAAATGGGGTTGTTAAGC CTTCGATTGTCCCTCTACATGTTGTGCAAAGCATGAACAAACTAAAAGAT ACGGACATACAAAAGCAATACATCAAACATCTTGTTTAGAATTTTGTCCA TGACATTCTCTCCCACTTATTCCTTCGACGTCATTGTCGAAGCCTTTGCC GACACTACAACTCGCCTTCACTAAGTCTTCAATCTTTTGCTTCAACTGCA ATGCGTCTTTTGGCTTCCAATTGCTCTCCGCTACTGTTGTTGAGTAGTCG AATTTTTGATCCACCATGCTGCTTCGACTTGCCAATGACTCTGACTCTAG TGTGGGGTTGGCTGAGTTGTGATGATCTCTGTTGGTTCCTGCGGATCTAT CAGATGAAGGAAAAAACCAACCTTACTATGCGTAAGTCTCTCAAATGCCT AATGCTGCTTGAACTGGGTGGATGCTTGTTGGAGCTTTAACGAGCATCGC CTCACAAACTTCCGAAATTTTAGGTCCTTCCTCCACAAAATTTACCCATT GACTCTTCTTTCATTTAGTTGTCACTTCCAAGTAGATTCGCATCACTTCC GCTTTCGATTGGCATTCTGTTGGAAAATGAAGCGGATAATCTACTCTCAG TAGTACTGATCATCATTGGTGAGGATTTGATAACTATTGTCTTCTATTAT CTTCAAAGGGTCTTTGAACTTGTGCAGAGCATTTCTGTTGGATAGATAAG AGAATTGGGGTACTAGGTTTCATCCATTCTCTTAAGAGTTGAGAAGACAA TGATTACTTGACTTCGCTCGCCTCCTTAAGGGTTGTACTCCATGCATCGA GTTGGTTACTGATCTTCGCCTACCCTTTGCTTACACTTCTGAAGCACTCG AAGTGTTTACACTCATTGCATTGAGTTAGCTACTGTGATTTACCTTCTCA ATACCATCGAACTTCTGGAATGCAGGAAGTTTTCACCCCAACTTGGAGTT AGTCTCTAATAGTTTTGGTCGCCTTTGGGATTGTACCGGCTTCTCCATCA ACCCTGCCGCCTACTCCACTGAGTAGCAAAGGTACAACACCGCGTACTGC TTGCTTCGTTCCTTGGTCGTGCACTCTTGCATGACTCGAAGTCCTTCACT TTCGGCTATCTTGATGAGAAGCTCGTTGATACCGGTCTTACGAAGTTCCT TGGCCTCTGCCCTTCAGCCTTGTCTTGGTACTTGGAGTTTGCCTCTGCAT GCTTCGCCTCCTCGGCCCCTTTCACGACCAAGCGCTCTCCTTCCATGAGA GCAAGGGATTAATGACTTTCACGGAAGTCCCGCCTCTGCGGTACCATGGT GCTGCCATGCTCATGGCCCTACTATCCGTTGCCTTGTATCTGCATCCCTT TTCTTCACGATCAGTAGATATGTCTCTGTGGCACTCCTCCGAGTCACCTC TATTCTAAATGATGCTTGATTTTGGGTAACTAAGTTCCTTTGGACTCCTC GTCGCTTCCTCACCCCTTTCCCCTGCTTCAACACCTCTGTGTTCTCTAAG CAGCTCCCTTTGGTCGATAGAAAGACAGACTGCAACTCCCATGCATGGCC TCTGCCATCATGCTGTAGGGTTTGCACCGATTCTGTTCTCTTTAGCTTAC TCGACCTCTGACTTGCCGGGCTCCCTTAAGCGAATATGGGCTCTGAAGTA GTCCAACTCTCCAGCTGCTTCGATCATACCTCTATATGATCAAGTCCCTC GGACTCACTAGTACTTGCATTCGAACTTTTTCCTCGGTGGTACACAGCCC CCATATGCTGATGACCAAAGCTTTTATTCGATGCAAAATTCAATGCACGC ACGGAAGACCCGCCTCTGCGGTACCATGTCCTTTACTCCTTAAATCCATA GCCCTTCTTGCCATTGTGTTGCTCACCAAAGTGGAGCTTCTAGTAGCTCC CGATCATACCTCCATATGATATAGTCCCTCACGGGGCTAGATTCGTGTGT ATCGCATTGTCACGAACTATTCCACCACGATCCGCTGCACTATGTCGCCT CTTGGTAACATCTCCATTGCATTATGATCATTGTGGGATGAACTCGAATT GTGATCCATCTATGTGTGGCCTCGGCCGATACATCGCTGGGTCTCTTTCA CCTTCGATTTTGTTCGCTCTTTTGGCAATCGACATTCGTCCACCTACTCT TGGGTCACACTCAGACGAAACACAACTCTAGGGTAGTCCATCGCCTAGTA GCTCCCGAAGTCCACCGACTTCGTTGAAAATGGTGCACCATTGTCTGGAT CTTGGGCCTCTGCCCCTACCAGCACAATCTCCACTACGCACTACTTCCTT CATGGCAACTTGAATGACAACACTGTGATATATTCTTCAAGAGTACCCGC CTCTGTGTCCTCTTGCCTCGTACCAAGGCCTTCTGAACCCAACTTCGCCT TAGTTCCTCCATCAAATACTTCTTCGAGATAAGGTGCATGTGCCTAGAAG CTCCCTTCATCTTTGGCACCATGTAATATGAGTCCGCTCCATCAGCATGA AGGACCCACGGAACGACATGATCCTACTCTTGCCTCTACAAGAGTTCATG TCCTTGATCTCTGCTCACGGAAAGCTTTGTGCCTCCGCTCCATGTTTCAT CTTCTATGTCGACTCCCTTCATGCAGCTTGGGTACTTCGCCAAGTTACAC CCAAGTTGCTCCGCTCCTCGTTTTTTGCATTGAGTTGATGGTGGCCCTCG CGCCCACCATTCCATTGGTCAGTCCTTCCTTGAGTCTGATCTCCATATCG ACTCCAAGTGTGCCTTTATTTGTGTTGCATTGGGTCGCTCCCTCACTTGA TCTCGCAATGCATCCACCAATGCATTCTCTCAAGCGAGGTCATGCAACGA CTCCTTGTCGCTCGCTTGGTCTATTGAGCTTTGTGAATTTATTTTTGAGG TACTCCTCAACATGTGCAGTCCGTTGCACATGGTTCTCCCTTTGGAGAGC CGGGACTTATCCCTCATGGATATTTGTCCCGTTGGAGCAACTTCTCTCTT CGCTTCCTTCTCTTTGAAAGTTTCGAAGACCATCATCCCCTTGGACTACT CCGCCTTGTTGAACAAACTGTGCATTGTTCTGCCTCCTACAAACGCACTT GCTAGATTGCGACTCCACGTCAATATAGCCCTCGCTGCACCCCTCAAGGC CTAGCAACATGCTGAACTCACTGCACACTTCAGCCTCCTACGGATGTATC CTTCTCATGCTGAAGAGAAAGTTTCAATGCTCTATGGCACCGAGTTTCAG TCACCTTGGGATGGTCACGAACACTCCATCGTTCGCATACAAGCCATTGC ATGAGTACCGAATTCTTTGAGTTAGTAATTCCTCTCACCTCCGTGAGCTT TGCACAACTCTTTCGGTCGCTAAGCAATTCATTCCACCTTGTATGGTCTC ATCCTTTACCAAGCGCCTCGCTTGCCTTGAGCACCATCAAGTATAGTTGT CAACGTCGAGCCGTAGCTCGAACTCAGCCATCCCAACTTTTGTGTGCTAC GAATTCTTCAAAGCTTGCTTGTTCTCGTGGTGCCTTTTGCGCGAAGGGTT GGCCATTCCTTTGAATGCCAATTTCAGATGCCCGCTCCTCCGAGCGACTC ATTTTCCCTACATCTTCATGCCCGTTTTCTCCTAAACGGTCGCGTGTGTG CTGACTGCCCTCAACGCAGCCTTGCTAGGTCTCCCACATTTGCATGTCAA GTGTTTCTATGAGTGCTTGTCCCGTTCTGATACCATCTGTCACAGACTTA ACTGGTTTTGCCCAAGTCGTGCGGTACCCTTGCGTGTCCGTCTGCAAAGG TCAGCCTCCTCGAAACCTCCCATGGTTCCTTAGGACCTACAAAAGAGAAA ACGGGTTAGAGAAAGCGCCTCACTCGGGATCCACAAGCAAACATTTCATG AAACATTTCATAGACAATACAAATTACAAACATACTTTACAAGCTCTGAA CGGTTGCACAACAAAGGGTCAAAATGGTCCACTACAGACCGAATATCTTT CACAAGTGTCCACATGACAACATTTATTTACAAGCCTAAGAAGGCCACCA AACCCAATTAAAATGAGACTGTTAAGCCTTCGACCGTCCCTCTACTATGC AAAACATGAACAAACTAAAAGACACGGACATACAAAAGCATTACATCAAA CATCCTGTTTAGAATTTTGTCCGTGACAGAGTGTTGAATACATCATATCT GGAGTTCTTTTTATAGTTGGAATACTAGTCCAGTTCATGGGGAGTCAAAT GATTGTTATTTGAGGCAGTTAGGGATTGTTTTTTCGGAAGCTCCAAATGT TGAGCCATTATTTGGTTGCACCTAAGATCTGCACGGAGTCCAAAGACTTA AAACAGCCAAAGAAATGAACATGCAAATAAACAGGGTGATGGAATCTTTT GGCTGCTGCTTTTTCTCAAGTATCTCATAATTGTAAGCAAATCAGAAGAA CTCTGTTTTGGTCACGGCTGAATAAGAGATTTTGCATGCATGTATGTTTT TATAATAAAATTTTCTGACCATGAACTCTTATTTCCTTTTTCTTTCCTAC TTTCTCTATCTTCTCACTTGATTTGAAAGTTTAATGAATAAGGAACTCAT GGATGGTGCTTGGTCAGATATTGCCCTATTTTTCTGGAGAAAAATTCTTT AATTCATCTTTTTTTAAGGTCTTAACAGTGGGTCTAAGTCAAGCTAGCTA GCTTCTATTCTTCCAAGTTCTAAGTTCCTCTGAACAATTAAAACTATGAT GCAATTCTAGCCTGTCCTATTTCAATCCTCAAGCTACATTAATTTTTGTC CATGTTCAATATGATGCTCCAGGTACCTGAAGAGTGGGCCAGGAAACCTT GAGAAGGACATTGAGAGAAGATTTAGTTATGCGTTGAGCAGGGAGGATAT TGAAAATGCCATCCTTGGTGGACCTTGAAAATGATAAAGGTAAGTTTTTA AAAATTGTCTTTCTATTGTTTTTAAATTTTTGCTGTATGTATCTTTAAAT TTACGTGTTAAATTTACTGTATTTTTCAGCTTGACAGGATTGTGGATATC TGAGAAGCTTCTTTATGAAGAATGCTCTGTTTTGGATTAAGCAAGTTAGC TATAGTTCTTCCAGATTTTTTTTTAATGCTTTCTATATTTCGCAGAATCA ACAGTATGCACTTTATGTTTGTAAATATTGATTTGTCATAATTTACTTTC ATAAACTACAAAGTGCATTTTCAGGTGGTCATTATCAAATCAATAGTCGA TTT
back to top

Coding sequence (CDS) from alignment at chrUn_random:35361837..35369139+

>Ma00_t04120.1 ID=Ma00_t04120.1|Name=Ma00_t04120.1|organism=Musa acuminata|type=CDS|length=510bp|location=Sequence derived from alignment at chrUn_random:35361837..35369139+ (Musa acuminata)
ATGTCGCCCACTCTCGTCTCGCTATCCATCGTAAACCCTACAGCCTTTGC
CGCCCGCAAATCCTCCCTCTTCCCCGGCGTCCGCCCTCTTCCCCCGCTCC
TGCCCTCTCGCCTCCAAACCCCAGCGGCCTTGCGGGGGTTCAGGAGGCGG
CGGCGCGGGTGGGGAGCGCTGGTTCCGCCCTCGGCGGCCGCGTCGGCGTT
CTCGGCGGCGGCTGAGGATGAGGAGTGGCTCAAGAAGCTCCCTGACAAGA
AGAAGCCTCTCTACTCCCACAGCCTCCCGTGCATCGAGGCGTGGTTCAGA
AAGCTTGGGTTCCGACAGAGCCGGGATGATCGAGCGGTGTGGGTCGTCGA
GAAACCCAACTGGCACGCCCAGCTCTCCCTCGATGTCACCGACCTTTACA
TAAGGTACCTGAAGAGTGGGCCAGGAAACCTTGAGAAGGACATTGAGAGA
AGATTTAGTTATGCGTTGAGCAGGGAGGATATTGAAAATGCCATCCTTGG
TGGACCTTGA
back to top