Overview
NameMa00_t03020.1
Unique NameMa00_t03020.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length1419
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:24506741..24508890 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
OriginRefSeq:rna44164
Old locus tagGSMUA_AchrUn_randomG19740_001
Old locus taggene32769
Previous locationchrUn_random:95453264..95455413
NoteArogenate dehydratase/prephenate dehydratase 6, chloroplastic
Cross References
External references for this mRNA
DatabaseAccession
GeneID103974533
GenbankXM_009389388.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g03020Ma00_g03020Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p03020.1Ma00_p03020.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2010474auto2010474Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2010475auto2010475Musa acuminataexon
exon-auto2010476auto2010476Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t03020.1 ID=Ma00_t03020.1|Name=Ma00_t03020.1|organism=Musa acuminata|type=mRNA|length=1419bp
ATGTATATGTCAACGATGGCGGCGGTCATGCTTTCCTCTGCGCCAAGGCA
TGTGCTCAGCCCCATTTTCCCGCCGCCGGACAACCATGTCCCGCCTCCTA
CGGCGCTCCCCAAGCGAGGACCAGCCTTCCGGCGGCTCCCCTCCGCCGTT
CTCCGCTCGGCCATCCGATCGATCTACGTGCCAGAATCCACCTCTGCCGC
CCCCTTCCCCGGCGCCCTCGGCTCCAGCCGCTCCGACTGGCAGACCAATT
GCGCCATCCTCGCCAGCAAGGCGGCGTCTAACTCCTCTTCTTCTTCATCC
TCCGGAGGAGACAACGCCGGCGCGGCATCTAATGAACCCAGAAGCAGCAA
CGATGGTAACCACTACCATCTGACGAGTCCTACTCCCGTCAACGGCCTGA
AGCAAAACTCGGCGACGCTGGACTTGGTGCCGGTGGCCAACCTCCCGCGG
CCCCTCTCCATCTCCGACCTCTCGCCCTCCCCGAAGCACGGGTCCAGCGT
CCGCGTGGCGTACCAGGGCGTGCCGGGGGCCTACAGCGAAGCGGCGGCCG
GAAAGGCCTACCCTAACTGCGAAGCCATCCCTTGCGACCAGTTCGAGGTG
GCCTTCCAGGCGGTGGAGCTCTGGATCGCGGACCGCGCCGTCCTCCCCGT
GGAGAACTCCCTGGGCGGCAGCATCCACCGCAACTACGACCTCCTCCTGC
GGCACCGGCTCCACATCGTGGGTGAGGTTCAGCTCCCTGTTCACCACTGC
CTCCTCGCCCTCCCGGGCGTTCGCAAGGAGCAGCTGACCCGGGTGATCAG
CCACCCTCAGGCGCTTTCCCAGTGCGAGCTGACGCTGACCGGGATGGGAC
TCAACGTGGCGCGGGAGGCCTTCGACGACACGGCAGGCGCCGCCGAGTAC
GTGGCCAACAACGGCCTCCGGGACACGGCGGCCATCGCGTCGGCGCGGGC
GGCGGAGCTGTACAAACTGCAGGTGTTGGCGGACGGCATCCAAGACGACA
GCGGCAACGTGACGCGGTTCGTGATGCTGGCGCGGGAGCCCATCATTCCG
CGCACCGACCGGCCCTTCAAGACCAGCATCGTGTTCGCCCACGACCGGGA
GGGCACCTCCGTCCTCTTCAAGGTGCTCTCCGCCTTCGCCTTCCGGGACA
TCAGCCTGACCAAGATCGAAAGCCGGCCGCACCGCCACCGGCCGCTGCGC
CTGGTGGACGACGCCAACGTGGGCACCGCCAAGCACTTCGAGTACATGTT
CTACGTCGACTTCGAAGCGTCCATGGCGGAGACCCGCGCCCAGAAAGCCC
TCGCCGAGGTCCAGGAGTACACCTCCTTCCTCCGCGTGCTCGGCAGCTAC
CCGATGGATATGACTCCCTGGGACGCATCCTCCTCGCCGTCCCCGCCGAC
GCCTCCCTCCTCGTCGTAG
back to top

protein sequence of Ma00_p03020.1

>Ma00_p03020.1 ID=Ma00_p03020.1|Name=Ma00_p03020.1|organism=Musa acuminata|type=polypeptide|length=473bp
MYMSTMAAVMLSSAPRHVLSPIFPPPDNHVPPPTALPKRGPAFRRLPSAV
LRSAIRSIYVPESTSAAPFPGALGSSRSDWQTNCAILASKAASNSSSSSS
SGGDNAGAASNEPRSSNDGNHYHLTSPTPVNGLKQNSATLDLVPVANLPR
PLSISDLSPSPKHGSSVRVAYQGVPGAYSEAAAGKAYPNCEAIPCDQFEV
AFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHC
LLALPGVRKEQLTRVISHPQALSQCELTLTGMGLNVAREAFDDTAGAAEY
VANNGLRDTAAIASARAAELYKLQVLADGIQDDSGNVTRFVMLAREPIIP
RTDRPFKTSIVFAHDREGTSVLFKVLSAFAFRDISLTKIESRPHRHRPLR
LVDDANVGTAKHFEYMFYVDFEASMAETRAQKALAEVQEYTSFLRVLGSY
PMDMTPWDASSSPSPPTPPSSS*
back to top

mRNA from alignment at chrUn_random:24506741..24508890+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t03020.1 ID=Ma00_t03020.1|Name=Ma00_t03020.1|organism=Musa acuminata|type=mRNA|length=2150bp|location=Sequence derived from alignment at chrUn_random:24506741..24508890+ (Musa acuminata)
CCCTCTCCTGCCCATCTACCACAAACCAGAGCCACAATAAAGCCTCTATC TCTGCCATTCCTGCTTTCTTCCAGCTTGAAAGGGTTCCTCTTCTCAAGCT TCTCTGCCATCTACTCTTCTTCTTATTTCATTTTTCTCTCTCTTACATCT TAAAGTATAATTCTGTCTGATATATGTATATGTCAACGATGGCGGCGGTC ATGCTTTCCTCTGCGCCAAGGCATGTGCTCAGCCCCATTTTCCCGCCGCC GGACAACCATGTCCCGCCTCCTACGGCGCTCCCCAAGCGAGGACCAGCCT TCCGGCGGCTCCCCTCCGCCGTTCTCCGCTCGGCCATCCGATCGATCTAC GTGCCAGAATCCACCTCTGCCGCCCCCTTCCCCGGCGCCCTCGGCTCCAG CCGCTCCGACTGGCAGACCAATTGCGCCATCCTCGCCAGCAAGGCGGCGT CTAACTCCTCTTCTTCTTCATCCTCCGGAGGAGACAACGCCGGCGCGGCA TCTAATGAACCCAGAAGCAGCAACGATGGTAACCACTACCATCTGACGAG TCCTACTCCCGTCAACGGCCTGAAGCAAAACTCGGCGACGCTGGACTTGG TGCCGGTGGCCAACCTCCCGCGGCCCCTCTCCATCTCCGACCTCTCGCCC TCCCCGAAGCACGGGTCCAGCGTCCGCGTGGCGTACCAGGGCGTGCCGGG GGCCTACAGCGAAGCGGCGGCCGGAAAGGCCTACCCTAACTGCGAAGCCA TCCCTTGCGACCAGTTCGAGGTGGCCTTCCAGGCGGTGGAGCTCTGGATC GCGGACCGCGCCGTCCTCCCCGTGGAGAACTCCCTGGGCGGCAGCATCCA CCGCAACTACGACCTCCTCCTGCGGCACCGGCTCCACATCGTGGGTGAGG TTCAGCTCCCTGTTCACCACTGCCTCCTCGCCCTCCCGGGCGTTCGCAAG GAGCAGCTGACCCGGGTGATCAGCCACCCTCAGGCGCTTTCCCAGTGCGA GCTGACGCTGACCGGGATGGGACTCAACGTGGCGCGGGAGGCCTTCGACG ACACGGCAGGCGCCGCCGAGTACGTGGCCAACAACGGCCTCCGGGACACG GCGGCCATCGCGTCGGCGCGGGCGGCGGAGCTGTACAAACTGCAGGTGTT GGCGGACGGCATCCAAGACGACAGCGGCAACGTGACGCGGTTCGTGATGC TGGCGCGGGAGCCCATCATTCCGCGCACCGACCGGCCCTTCAAGACCAGC ATCGTGTTCGCCCACGACCGGGAGGGCACCTCCGTCCTCTTCAAGGTGCT CTCCGCCTTCGCCTTCCGGGACATCAGCCTGACCAAGATCGAAAGCCGGC CGCACCGCCACCGGCCGCTGCGCCTGGTGGACGACGCCAACGTGGGCACC GCCAAGCACTTCGAGTACATGTTCTACGTCGACTTCGAAGCGTCCATGGC GGAGACCCGCGCCCAGAAAGCCCTCGCCGAGGTCCAGGAGTACACCTCCT TCCTCCGCGTGCTCGGCAGCTACCCGATGGATATGACTCCCTGGGACGCA TCCTCCTCGCCGTCCCCGCCGACGCCTCCCTCCTCGTCGTAGTCACCTTG ATCGATTGGCTCTGGTCCGTCAGTTTCCTCCTATCCCCAATCTGACGGGT GAGATTGGTCAAAACCAAACACCGCCTTTTTTTACCAACCTTATTGCGTT TGATTACTGTGTTACATATCTTTATTTTGTTTCTTTTAGGGTTCTATCGC GAACTAAAAGAATGGAATATGAAATCTTTAATTTGGATTATGATTCTCGT ACGTGCAATGTGCTCTGCCAAAATTGTACCAGCTTCTTGTGATGGGTCCC ACGCACACCATTGGCCGGAGACCGTGACTCCTAAGTTGAGGGTCATCAAA AGCTACAACCTAAACTACAGCAGTGTACGTCAATTACTTTTGGAGAGGGT ATCATTTTGTGGCGAGGTGGTTGTCCACCAAAAGCTTGGAACTTTAGTAT GCAAGACATTATTATTCGCACGGTATTAACAATGACAAAAATATAACTAC ATCTGTGGGTTGTATATATAGTATATACAAATACCAGTTCTAGTGACAGC AGGTCACTTTCAACACAGATCACACACTAACCATTAAGTCGAAGTGGAAA
back to top

Coding sequence (CDS) from alignment at chrUn_random:24506741..24508890+

>Ma00_t03020.1 ID=Ma00_t03020.1|Name=Ma00_t03020.1|organism=Musa acuminata|type=CDS|length=1419bp|location=Sequence derived from alignment at chrUn_random:24506741..24508890+ (Musa acuminata)
ATGTATATGTCAACGATGGCGGCGGTCATGCTTTCCTCTGCGCCAAGGCA
TGTGCTCAGCCCCATTTTCCCGCCGCCGGACAACCATGTCCCGCCTCCTA
CGGCGCTCCCCAAGCGAGGACCAGCCTTCCGGCGGCTCCCCTCCGCCGTT
CTCCGCTCGGCCATCCGATCGATCTACGTGCCAGAATCCACCTCTGCCGC
CCCCTTCCCCGGCGCCCTCGGCTCCAGCCGCTCCGACTGGCAGACCAATT
GCGCCATCCTCGCCAGCAAGGCGGCGTCTAACTCCTCTTCTTCTTCATCC
TCCGGAGGAGACAACGCCGGCGCGGCATCTAATGAACCCAGAAGCAGCAA
CGATGGTAACCACTACCATCTGACGAGTCCTACTCCCGTCAACGGCCTGA
AGCAAAACTCGGCGACGCTGGACTTGGTGCCGGTGGCCAACCTCCCGCGG
CCCCTCTCCATCTCCGACCTCTCGCCCTCCCCGAAGCACGGGTCCAGCGT
CCGCGTGGCGTACCAGGGCGTGCCGGGGGCCTACAGCGAAGCGGCGGCCG
GAAAGGCCTACCCTAACTGCGAAGCCATCCCTTGCGACCAGTTCGAGGTG
GCCTTCCAGGCGGTGGAGCTCTGGATCGCGGACCGCGCCGTCCTCCCCGT
GGAGAACTCCCTGGGCGGCAGCATCCACCGCAACTACGACCTCCTCCTGC
GGCACCGGCTCCACATCGTGGGTGAGGTTCAGCTCCCTGTTCACCACTGC
CTCCTCGCCCTCCCGGGCGTTCGCAAGGAGCAGCTGACCCGGGTGATCAG
CCACCCTCAGGCGCTTTCCCAGTGCGAGCTGACGCTGACCGGGATGGGAC
TCAACGTGGCGCGGGAGGCCTTCGACGACACGGCAGGCGCCGCCGAGTAC
GTGGCCAACAACGGCCTCCGGGACACGGCGGCCATCGCGTCGGCGCGGGC
GGCGGAGCTGTACAAACTGCAGGTGTTGGCGGACGGCATCCAAGACGACA
GCGGCAACGTGACGCGGTTCGTGATGCTGGCGCGGGAGCCCATCATTCCG
CGCACCGACCGGCCCTTCAAGACCAGCATCGTGTTCGCCCACGACCGGGA
GGGCACCTCCGTCCTCTTCAAGGTGCTCTCCGCCTTCGCCTTCCGGGACA
TCAGCCTGACCAAGATCGAAAGCCGGCCGCACCGCCACCGGCCGCTGCGC
CTGGTGGACGACGCCAACGTGGGCACCGCCAAGCACTTCGAGTACATGTT
CTACGTCGACTTCGAAGCGTCCATGGCGGAGACCCGCGCCCAGAAAGCCC
TCGCCGAGGTCCAGGAGTACACCTCCTTCCTCCGCGTGCTCGGCAGCTAC
CCGATGGATATGACTCCCTGGGACGCATCCTCCTCGCCGTCCCCGCCGAC
GCCTCCCTCCTCGTCGTAG
back to top