Overview
NameMa00_t02950.1
Unique NameMa00_t02950.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length1356
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:22651378..22653857 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
OriginRefSeq:rna43870
Old locus tagGSMUA_AchrUn_randomG17070_001
Old locus taggene32536
Previous locationchrUn_random:80809395..80811595
NoteUncharacterized protein
Cross References
External references for this mRNA
DatabaseAccession
GeneID103974285
GenbankXM_009389071.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g02950Ma00_g02950Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p02950.1Ma00_p02950.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2010380auto2010380Musa acuminataCDS
CDS-auto2010381auto2010381Musa acuminataCDS
CDS-auto2010382auto2010382Musa acuminataCDS
CDS-auto2010383auto2010383Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2010384auto2010384Musa acuminataexon
exon-auto2010385auto2010385Musa acuminataexon
exon-auto2010386auto2010386Musa acuminataexon
exon-auto2010387auto2010387Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t02950.1 ID=Ma00_t02950.1|Name=Ma00_t02950.1|organism=Musa acuminata|type=mRNA|length=1356bp
ATGAGGCTCGGCTTCCTCCTTCCTTGCATCACCGTGCTGCTTGTTACTGG
TAGCGTGTGCAAGCTGGCACATAATTCATCAGCGTTGCCCCTCTCGTCGA
GCTCCCGGTGGATCGTCGATGAGTCCGGCCTGCGAGTTAAGCTAGCTTGC
GTCAACTGGGTGTCCCACCTGGAGCCCGTGGTGGTGGAGGGCATGGGGAA
GCAGCCACTGGACACCATATCCAAGAAGATCGCCGCCATGGGCTTCAACT
GCGTTAGGCTCACTTGGCCTCTCTTCTTGGTCACCAACGACTCCCTGGCC
GGCCTCACCGTCCGGCAGTCTTTCCAGGCTCTCGGCCTAATGGAGTCCAT
CGCCGCCATCCAAGTCAACAACCCAGATCTTCTCAACCTCACGCTCATCC
AGGCATTCAAGGCCGTGGTGTCCAATCTTGCTGATAACAACGTCATGGTG
ATCTTAGATAACCACATCAGCAAACCCGGATGGTGCTGCAGTAACTTCGA
CGGCAATGGCTTCTTCGGCGACAAGTACTTCGACGCCGAAGAGTGGATCA
AGGGGCTCACAAAGATGGCCACAATGTTCAACGGCTCGCCCAACGTAGTC
GGCATGAGCCTGAGGAACGAGCTCAGAGGTCCGAAGCAAGGCGTTACTGA
ATGGTACAGGTACATGCAAAGGGGTGCGGAAGCAGTGCACTCGGCGAACC
CCAACGTTCTTGTCATACTGTCGGGCCTCAGCTTCGACAACGACCTGGGC
TACCTCTCCAAGAAGCCCGTCGAGCTAACGTTCCAAGGGAAGCTCGTCTT
CGAGCTGCACTGGTACGCCTTCTCCGACGGCCAGGCTTGGGCGAATGGAA
ACCCTAACCAAGTGTGTGGGCGAGTAGCGGGGAACGTGATGAGGAGGGCA
GGGTTCTTGCTGGACCAGGGGTGGCCACTGTTCTTGAGCGAGTTTGGACT
GGACCAGAGAGGCACAAATGTCAACGACAACAGGTACCTGGGATGCATGA
TGGGGGTTGCAGCTGAACTGGATTTGGACTGGGCATTGTGGACCTTGCAG
GGGAGCTACTACATCAGGCAGGGTTCAAAATGGGAGTTCATATCAGACTC
CAAGATGCATCTGTCAACCAAGATGTCCAGTGATGGCTGCAGCCTATGCT
TGGATGTTGACCCCGATGGCATCAGCATCATCACGAATCCATGCAGGTGC
TTGACGAATGATCAAACATGCAATCCAGAGAGCCAGTGGTTCAAGATGAT
AAGCAGCACGAGGAAGACTGCGAGCAAGAACTCCATTCTGCGGTTGCCTT
CGCGACCTGAAATTTGGAGGTTCGTGAGGAATCGAGCCCTTGAATCCTCC
GTGTGA
back to top

protein sequence of Ma00_p02950.1

>Ma00_p02950.1 ID=Ma00_p02950.1|Name=Ma00_p02950.1|organism=Musa acuminata|type=polypeptide|length=452bp
MRLGFLLPCITVLLVTGSVCKLAHNSSALPLSSSSRWIVDESGLRVKLAC
VNWVSHLEPVVVEGMGKQPLDTISKKIAAMGFNCVRLTWPLFLVTNDSLA
GLTVRQSFQALGLMESIAAIQVNNPDLLNLTLIQAFKAVVSNLADNNVMV
ILDNHISKPGWCCSNFDGNGFFGDKYFDAEEWIKGLTKMATMFNGSPNVV
GMSLRNELRGPKQGVTEWYRYMQRGAEAVHSANPNVLVILSGLSFDNDLG
YLSKKPVELTFQGKLVFELHWYAFSDGQAWANGNPNQVCGRVAGNVMRRA
GFLLDQGWPLFLSEFGLDQRGTNVNDNRYLGCMMGVAAELDLDWALWTLQ
GSYYIRQGSKWEFISDSKMHLSTKMSSDGCSLCLDVDPDGISIITNPCRC
LTNDQTCNPESQWFKMISSTRKTASKNSILRLPSRPEIWRFVRNRALESS
V*
back to top

mRNA from alignment at chrUn_random:22651378..22653857+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t02950.1 ID=Ma00_t02950.1|Name=Ma00_t02950.1|organism=Musa acuminata|type=mRNA|length=2480bp|location=Sequence derived from alignment at chrUn_random:22651378..22653857+ (Musa acuminata)
AAGGCAAGAAAAAATCCAATGCTTGAAGTGCAGTTCAACACTTCCAAATC TTACAACTGCAGGGAAGGAATAGTTCACCAAGATGATGAGCATGACATGA AGCTACGATCCCATACGCATCTTCCACAAGTGGACAGCTTAAATGACTTG GAAGCCTCAAGTTTCTCGACCTCCGCACTTGTTTTACTTGTTTAAAGCAG CTGCAGCAGTCCACACGCTATATAATCTCACCACCACAGCAACAAGCTCG AACAGCAAACCGCAAGCATGAGGCTCGGCTTCCTCCTTCCTTGCATCACC GTGCTGCTTGTTACTGGTAGCGTGTGCAAGCTGGCACATAATTCATCAGC GTTGCCCCTCTCGTCGAGCTCCCGGTGGATCGTCGATGAGTCCGGCCTGC GAGTTAAGCTAGCTTGCGTCAACTGGGTGTCCCACCTGGAGCCCGTGGTG GTGGAGGGCATGGGGAAGCAGCCACTGGACACCATATCCAAGAAGATCGC CGCCATGGGCTTCAACTGCGTTAGGCTCACTTGGCCTCTCTTCTTGGTCA CCAACGACTCCCTGGCCGGCCTCACCGTCCGGCAGTCTTTCCAGGCTCTC GGCCTAATGGAGTCCATCGCCGCCATCCAAGTCAACAACCCAGATCTTCT CAACCTCACGCTCATCCAGGCATTCAAGGTTAGGCCATCCAATCACAAAA AACGTATCTGCTGTCGACTTTTTCGTCTCTAAGCGATCCAAGTCGACTTC ATATTCATTAATTTACGAGAGCAGTGATCTTATCCAGTCACGACGATGAC AATAATGGATAAGCTCCAGGGAGAAGTTCACGACAAGTTGAAGCCACGTG CAGTACATCGATTATTGCATCTGCCCTTATCATAAACCCATTAATTAGTG CCAATCTGACTTGGAATCCTGACGAGCAGGCCGTGGTGTCCAATCTTGCT GATAACAACGTCATGGTGATCTTAGATAACCACATCAGCAAACCCGGATG GTGCTGCAGTAACTTCGACGGCAATGGCTTCTTCGGCGACAAGTACTTCG ACGCCGAAGAGTGGATCAAGGGGCTCACAAAGATGGCCACAATGTTCAAC GGCTCGCCCAACGTAGTCGGCATGAGCCTGAGGAACGAGCTCAGAGGTCC GAAGCAAGGCGTTACTGAATGGTACAGGTATACAAATGTACCGAAAGGTC ATAATGTATCGAGATGTACTACGACGGCTACAATGCTACATGTTCCCCGT TGTGCTGTGCTTTTAGGTACATGCAAAGGGGTGCGGAAGCAGTGCACTCG GCGAACCCCAACGTTCTTGTCATACTGTCGGGCCTCAGCTTCGACAACGA CCTGGGCTACCTCTCCAAGAAGCCCGTCGAGCTAACGTTCCAAGGGAAGC TCGTCTTCGAGCTGCACTGGTACGCCTTCTCCGACGGCCAGGCTTGGGCG AATGGAAACCCTAACCAAGTGTGTGGGCGAGTAGCGGGGAACGTGATGAG GAGGGCAGGGTTCTTGCTGGACCAGGGGTGGCCACTGTTCTTGAGCGAGT TTGGACTGGACCAGAGAGGCACAAATGTCAACGACAACAGGTACCTGGGA TGCATGATGGGGGTTGCAGCTGAACTGGATTTGGACTGGGCATTGTGGAC CTTGCAGGGGAGCTACTACATCAGGCAGGGTGTTCTTGCCATGGATGAGA CCTATGGGTTGCTGACCTGGGACTGGTCCAAGCCCAGGAACTCCGGCTTG TTGCAGAGGATTCAAGCCATCCAATCTCCCTTTCAAGGTATGAGTAACTT CCTTGCTTTATGATACATTCATGTAAGACTTGCTTTAAGAGTTGTAAGAT TCCTCGATGCAGGTCCAGGTCTTTCTGATCTTTCACCGTACAGCATAATC TTCCATCCATCAACTGGGCTGTGTGTTCTAAGGACATCTTTGCTTGGACC AATTGAGTTAGGCCCCTGTGATGAATCAGATGTTTGGAGCTACACAGAGC AGCAGACTCTGACATTAAAGGATAAGCTCCTTTGTCTGAAAGCTGATGGC ACAGGGAAGCCAGCCAGGCTTGGAATCATCTGCAGCGACACCCAGTCAAA ATGGGAGTTCATATCAGACTCCAAGATGCATCTGTCAACCAAGATGTCCA GTGATGGCTGCAGCCTATGCTTGGATGTTGACCCCGATGGCATCAGCATC ATCACGAATCCATGCAGGTGCTTGACGAATGATCAAACATGCAATCCAGA GAGCCAGTGGTTCAAGATGATAAGCAGCACGAGGAAGACTGCGAGCAAGA ACTCCATTCTGCGGTTGCCTTCGCGACCTGAAATTTGGAGGTTCGTGAGG AATCGAGCCCTTGAATCCTCCGTGTGATGATTCCTTTGACTTGTGGCTGC AAGTTTCTCATGTACGGGAGCTCTGTTCCGACCAAATGTCCAAAAATAAT CTGAAATAAGATTTTTTTTGTGCTTCTCTA
back to top

Coding sequence (CDS) from alignment at chrUn_random:22651378..22653857+

>Ma00_t02950.1 ID=Ma00_t02950.1|Name=Ma00_t02950.1|organism=Musa acuminata|type=CDS|length=1356bp|location=Sequence derived from alignment at chrUn_random:22651378..22653857+ (Musa acuminata)
ATGAGGCTCGGCTTCCTCCTTCCTTGCATCACCGTGCTGCTTGTTACTGG
TAGCGTGTGCAAGCTGGCACATAATTCATCAGCGTTGCCCCTCTCGTCGA
GCTCCCGGTGGATCGTCGATGAGTCCGGCCTGCGAGTTAAGCTAGCTTGC
GTCAACTGGGTGTCCCACCTGGAGCCCGTGGTGGTGGAGGGCATGGGGAA
GCAGCCACTGGACACCATATCCAAGAAGATCGCCGCCATGGGCTTCAACT
GCGTTAGGCTCACTTGGCCTCTCTTCTTGGTCACCAACGACTCCCTGGCC
GGCCTCACCGTCCGGCAGTCTTTCCAGGCTCTCGGCCTAATGGAGTCCAT
CGCCGCCATCCAAGTCAACAACCCAGATCTTCTCAACCTCACGCTCATCC
AGGCATTCAAGGCCGTGGTGTCCAATCTTGCTGATAACAACGTCATGGTG
ATCTTAGATAACCACATCAGCAAACCCGGATGGTGCTGCAGTAACTTCGA
CGGCAATGGCTTCTTCGGCGACAAGTACTTCGACGCCGAAGAGTGGATCA
AGGGGCTCACAAAGATGGCCACAATGTTCAACGGCTCGCCCAACGTAGTC
GGCATGAGCCTGAGGAACGAGCTCAGAGGTCCGAAGCAAGGCGTTACTGA
ATGGTACAGGTACATGCAAAGGGGTGCGGAAGCAGTGCACTCGGCGAACC
CCAACGTTCTTGTCATACTGTCGGGCCTCAGCTTCGACAACGACCTGGGC
TACCTCTCCAAGAAGCCCGTCGAGCTAACGTTCCAAGGGAAGCTCGTCTT
CGAGCTGCACTGGTACGCCTTCTCCGACGGCCAGGCTTGGGCGAATGGAA
ACCCTAACCAAGTGTGTGGGCGAGTAGCGGGGAACGTGATGAGGAGGGCA
GGGTTCTTGCTGGACCAGGGGTGGCCACTGTTCTTGAGCGAGTTTGGACT
GGACCAGAGAGGCACAAATGTCAACGACAACAGGTACCTGGGATGCATGA
TGGGGGTTGCAGCTGAACTGGATTTGGACTGGGCATTGTGGACCTTGCAG
GGGAGCTACTACATCAGGCAGGGTTCAAAATGGGAGTTCATATCAGACTC
CAAGATGCATCTGTCAACCAAGATGTCCAGTGATGGCTGCAGCCTATGCT
TGGATGTTGACCCCGATGGCATCAGCATCATCACGAATCCATGCAGGTGC
TTGACGAATGATCAAACATGCAATCCAGAGAGCCAGTGGTTCAAGATGAT
AAGCAGCACGAGGAAGACTGCGAGCAAGAACTCCATTCTGCGGTTGCCTT
CGCGACCTGAAATTTGGAGGTTCGTGAGGAATCGAGCCCTTGAATCCTCC
GTGTGA
back to top