Overview
NameMa00_t00190.1
Unique NameMa00_t00190.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length480
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:203316..204118 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteUncharacterized protein
OriginRefSeq:rna8378
Previous locationchr3:16494264..16495066
Cross References
External references for this mRNA
DatabaseAccession
GeneID103978375
GenbankXM_009394151.1
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t00190.1 ID=Ma00_t00190.1|Name=Ma00_t00190.1|organism=Musa acuminata|type=mRNA|length=480bp
ATGGCAGAGGATGAGGAAGCAGCAAGTTTCAAACTTTTCGGAGCAGTGAT
CCTAAAGGGGGAGAGACAAACCAAGGAAGAAGAGGAGACGGGTGCTCGGA
CGGCGCCAGCGTCGGGTGGGGCGGTCGAGGCGGCGGAGGCGGTGGCGAGG
GGAGCGGCATCGCTGCCGTGCCCAAGGTGCAAGAGCAGGGAGACCAAGTT
CTGCTACTTCAACAATTATAACGTCAACCAGCCGCGGCACTTCTGCAAGG
CCTGCCACCGCTACTGGACCGCCGGCGGCGCCCTCCGCAACGTCCCCGTC
GGCGCTGGTCGCCGCAGGGGCCGCCCCGCCCACCGCGGCGGAGGCGGCGT
CGTCCCGGCTGCATGCGTCCTAGACTACCCGTCGCCGGGGTACCTGGGCG
GGGCGGCGGCGGAGCGGTGGCTCCTGAGGCCGGAGGCGCCGGCGGGGGCT
GACCGCGGCCTCGACGGTGGGATTCGTTGA
back to top

protein sequence of Ma00_p00190.1

>Ma00_p00190.1 ID=Ma00_p00190.1|Name=Ma00_p00190.1|organism=Musa acuminata|type=polypeptide|length=160bp
MAEDEEAASFKLFGAVILKGERQTKEEEETGARTAPASGGAVEAAEAVAR
GAASLPCPRCKSRETKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPV
GAGRRRGRPAHRGGGGVVPAACVLDYPSPGYLGGAAAERWLLRPEAPAGA
DRGLDGGIR*
back to top

mRNA from alignment at chrUn_random:203316..204118-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t00190.1 ID=Ma00_t00190.1|Name=Ma00_t00190.1|organism=Musa acuminata|type=mRNA|length=803bp|location=Sequence derived from alignment at chrUn_random:203316..204118- (Musa acuminata)
TCTCTCTCTCTCTCTCTCTCGTGATGGCAGAGGATGAGGAAGCAGCAAGT TTCAAACTTTTCGGAGCAGTGATCCTAAAGGGGGAGAGACAAACCAAGGA AGAAGAGGAGACGGGTGCTCGGACGGCGCCAGCGTCGGGTGGGGCGGTCG AGGCGGCGGAGGCGGTGGCGAGGGGAGCGGCATCGCTGCCGTGCCCAAGG TGCAAGAGCAGGGAGACCAAGTTCTGCTACTTCAACAATTATAACGTCAA CCAGCCGCGGCACTTCTGCAAGGCCTGCCACCGCTACTGGACCGCCGGCG GCGCCCTCCGCAACGTCCCCGTCGGCGCTGGTCGCCGCAGGGGCCGCCCC GCCCACCGCGGCGGAGGCGGCGTCGTCCCGGCTGCATGCGTCCTAGACTA CCCGTCGCCGGGGTACCTGGGCGGGGCGGCGGCGGAGCGGTGGCTCCTGA GGCCGGAGGCGCCGGCGGGGGCTGACCGCGGCCTCGACGGTGGGATTCGT TGACTTCTCTGGGGCGAGGTGAAACGCTCCAGTTCCGGTGTGCGTCTCGC GTAGAAGAAAAAAGGATCTGTACGTGCGTGGCCTAAACGTAACATAATTC CAAAGTGCGAGCCCACATAGCAAAGCTGTTGCTTCTCTCTCTGTTCTCTC TCCCCTTTTCTTTCTTTGGTGATCTTAATATCTTGTTTTTAGTGTTATCA TTGTACAGGCTGAGATCATTAATGGCCTAATTTAGATTTTGTTTTCGCAA CCTCGATCATTTTCAGATTTATTAATTTTGATTCTATCTCAGAATATAGC CTG
back to top

Coding sequence (CDS) from alignment at chrUn_random:203316..204118-

>Ma00_t00190.1 ID=Ma00_t00190.1|Name=Ma00_t00190.1|organism=Musa acuminata|type=CDS|length=480bp|location=Sequence derived from alignment at chrUn_random:203316..204118- (Musa acuminata)
ATGGCAGAGGATGAGGAAGCAGCAAGTTTCAAACTTTTCGGAGCAGTGAT
CCTAAAGGGGGAGAGACAAACCAAGGAAGAAGAGGAGACGGGTGCTCGGA
CGGCGCCAGCGTCGGGTGGGGCGGTCGAGGCGGCGGAGGCGGTGGCGAGG
GGAGCGGCATCGCTGCCGTGCCCAAGGTGCAAGAGCAGGGAGACCAAGTT
CTGCTACTTCAACAATTATAACGTCAACCAGCCGCGGCACTTCTGCAAGG
CCTGCCACCGCTACTGGACCGCCGGCGGCGCCCTCCGCAACGTCCCCGTC
GGCGCTGGTCGCCGCAGGGGCCGCCCCGCCCACCGCGGCGGAGGCGGCGT
CGTCCCGGCTGCATGCGTCCTAGACTACCCGTCGCCGGGGTACCTGGGCG
GGGCGGCGGCGGAGCGGTGGCTCCTGAGGCCGGAGGCGCCGGCGGGGGCT
GACCGCGGCCTCGACGGTGGGATTCGTTGA
back to top
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g00190Ma00_g00190Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p00190.1Ma00_p00190.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2006533auto2006533Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2006534auto2006534Musa acuminataexon