Overview
NameMa00_t00150.1
Unique NameMa00_t00150.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length435
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:181890..182385 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteGlutaredoxin-C9
OriginRefSeq:rna8382
Old locus tagGSMUA_Achr3G15490_001
Old locus taggene6191
Previous locationchr3:16517280..16517775
Cross References
External references for this mRNA
DatabaseAccession
GeneID103978379
GenbankXM_009394155.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g00150Ma00_g00150Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p00150.1Ma00_p00150.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2006503auto2006503Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2006504auto2006504Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t00150.1 ID=Ma00_t00150.1|Name=Ma00_t00150.1|organism=Musa acuminata|type=mRNA|length=435bp
ATGCAAGACGCGATCCCGTACAGATCCGCGCGGGGCTGGTTCCCGACGTC
GCCTTCGTCCTCATCCGCCTCGCCCTCCTCCTCTTCCCTCGGTGGAGTGA
CCGTGCGGATGATGGTGGCGGAGAACCCGGTGGTGGTGGTGGGGCGGCGG
AGTTGCTGCATGGTCGACGTGGCAAGGCGCCTTCTGCTGGGGCTCGGGGT
CAACCCCGTGGTGCGCGAGATCGGAGAGGAGGCCGCCGCCGTAGAGGAGG
CGGCAGCCCTGGTGGAGGCGGTGGCCGAGGTCGGGGGCGCCGGTGGGGAT
CGACGGCGGTCGTCAAAGCTCCCAGTGGTGTTCGTTGGGGGAAGGCTACT
AGGAGGCCTCGATCGCCTCGTCACCGCCCACATCACCGGCGATCTCGTGC
CCATCTTGAAAGATGCCGGCGCTCTCTGGCTCTAA
back to top

protein sequence of Ma00_p00150.1

>Ma00_p00150.1 ID=Ma00_p00150.1|Name=Ma00_p00150.1|organism=Musa acuminata|type=polypeptide|length=145bp
MQDAIPYRSARGWFPTSPSSSSASPSSSSLGGVTVRMMVAENPVVVVGRR
SCCMVDVARRLLLGLGVNPVVREIGEEAAAVEEAAALVEAVAEVGGAGGD
RRRSSKLPVVFVGGRLLGGLDRLVTAHITGDLVPILKDAGALWL*
back to top

mRNA from alignment at chrUn_random:181890..182385-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t00150.1 ID=Ma00_t00150.1|Name=Ma00_t00150.1|organism=Musa acuminata|type=mRNA|length=496bp|location=Sequence derived from alignment at chrUn_random:181890..182385- (Musa acuminata)
CCTCGATTTCCCCCGAACGGTTCCAGAATGCAAGACGCGATCCCGTACAG ATCCGCGCGGGGCTGGTTCCCGACGTCGCCTTCGTCCTCATCCGCCTCGC CCTCCTCCTCTTCCCTCGGTGGAGTGACCGTGCGGATGATGGTGGCGGAG AACCCGGTGGTGGTGGTGGGGCGGCGGAGTTGCTGCATGGTCGACGTGGC AAGGCGCCTTCTGCTGGGGCTCGGGGTCAACCCCGTGGTGCGCGAGATCG GAGAGGAGGCCGCCGCCGTAGAGGAGGCGGCAGCCCTGGTGGAGGCGGTG GCCGAGGTCGGGGGCGCCGGTGGGGATCGACGGCGGTCGTCAAAGCTCCC AGTGGTGTTCGTTGGGGGAAGGCTACTAGGAGGCCTCGATCGCCTCGTCA CCGCCCACATCACCGGCGATCTCGTGCCCATCTTGAAAGATGCCGGCGCT CTCTGGCTCTAATTTCCCCATCTTTTCTTCTTATATATATATATAT
back to top

Coding sequence (CDS) from alignment at chrUn_random:181890..182385-

>Ma00_t00150.1 ID=Ma00_t00150.1|Name=Ma00_t00150.1|organism=Musa acuminata|type=CDS|length=435bp|location=Sequence derived from alignment at chrUn_random:181890..182385- (Musa acuminata)
ATGCAAGACGCGATCCCGTACAGATCCGCGCGGGGCTGGTTCCCGACGTC
GCCTTCGTCCTCATCCGCCTCGCCCTCCTCCTCTTCCCTCGGTGGAGTGA
CCGTGCGGATGATGGTGGCGGAGAACCCGGTGGTGGTGGTGGGGCGGCGG
AGTTGCTGCATGGTCGACGTGGCAAGGCGCCTTCTGCTGGGGCTCGGGGT
CAACCCCGTGGTGCGCGAGATCGGAGAGGAGGCCGCCGCCGTAGAGGAGG
CGGCAGCCCTGGTGGAGGCGGTGGCCGAGGTCGGGGGCGCCGGTGGGGAT
CGACGGCGGTCGTCAAAGCTCCCAGTGGTGTTCGTTGGGGGAAGGCTACT
AGGAGGCCTCGATCGCCTCGTCACCGCCCACATCACCGGCGATCTCGTGC
CCATCTTGAAAGATGCCGGCGCTCTCTGGCTCTAA
back to top