Overview
NameMa00_t00090.1
Unique NameMa00_t00090.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length816
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:113641..114493 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NotePutative Uncharacterized protein
OriginCIRAD:GSMUA_Achr3T15560_001
Old locus tagGSMUA_Achr3G15560_001
Old locus tagGSMUA_Achr3G15560_001
Old locus taggene6197
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t00090.1 ID=Ma00_t00090.1|Name=Ma00_t00090.1|organism=Musa acuminata|type=mRNA|length=816bp
ATGCTATATAGGCTTCTCTGCGATTCAACTTCACAGCTTCTCTTCAATCC
GAAACGTCTTCTGAGCTCCACAACCCTCATGGAGAAGAAGTCTGAATCAA
ACCAGATGCTGCTCGAGAACGTATGGGCCAGCTTCATCAATGGCAGTCAC
CGACCAGCCATTGGATCCGCGACCTGGGAAGATCTACCCAACCTGGAGAG
CAGGAACGAGAACCTGGCGCTCATCCAAAGACTTCCAAGCCTTGGGAGAT
GGATCTCCATGGGGGCTGAGACGTGGGAGGAGCTGCTTGATGGAACTTGC
AGCGTCTCAAACTGCAGCCCAACTCCTGCTACCGAATCAGCCCGCAGTAC
GAGGCCGACAGCTGCCGGAGCGGAAAGGGAGACGACCAGGCATTATAGGG
GCGTGAGGAGGCGGCCATGGGGGAAGTTTGCAGCAGAAATCAGGGACATA
TCCAGGAAAGGAGCTCGGGTTTGGCTGGGGACGTTCAACACTGCAGAGGA
AGCCGCCATAGCATATGACAGAGCTGCGTTGAGGATGAGAGGGCCCCGAG
CTCACCTGAACTTTCCACTGGAGACGGCCATCAGGAGCTCCAAAAGCACT
CGCTATGAGCAGCCGTCAACCTGCGCGCTGTGCGACGAGGCATGCTCTGT
TTACGGCTGCACCGCAGCAATTCATGAGCGAGCGGATTTGGACGAGGAGC
GACCGGCATGTAGAAGAGAAAGGAGCATCGAGGGGATGATCAACAACCGA
AGAGATGTGGTGGAGTTGCAAGACCTTGGCACTGACTACTTGGAAAGCTT
GTTGTCTCAAGAGTAA
back to top

protein sequence of Ma00_p00090.1

>Ma00_p00090.1 ID=Ma00_p00090.1|Name=Ma00_p00090.1|organism=Musa acuminata|type=polypeptide|length=272bp
MLYRLLCDSTSQLLFNPKRLLSSTTLMEKKSESNQMLLENVWASFINGSH
RPAIGSATWEDLPNLESRNENLALIQRLPSLGRWISMGAETWEELLDGTC
SVSNCSPTPATESARSTRPTAAGAERETTRHYRGVRRRPWGKFAAEIRDI
SRKGARVWLGTFNTAEEAAIAYDRAALRMRGPRAHLNFPLETAIRSSKST
RYEQPSTCALCDEACSVYGCTAAIHERADLDEERPACRRERSIEGMINNR
RDVVELQDLGTDYLESLLSQE*
back to top

mRNA from alignment at chrUn_random:113641..114493+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t00090.1 ID=Ma00_t00090.1|Name=Ma00_t00090.1|organism=Musa acuminata|type=mRNA|length=853bp|location=Sequence derived from alignment at chrUn_random:113641..114493+ (Musa acuminata)
TGAGCTGTGTGGTCGCTGGCAATGCTATATAGGCTTCTCTGCGATTCAAC TTCACAGCTTCTCTTCAATCCGAAACGTCTTCTGAGCTCCACAACCCTCA TGGAGAAGAAGTCTGAATCAAACCAGATGCTGCTCGAGAACGTATGGGCC AGCTTCATCAATGGCAGTCACCGACCAGCCATTGGATCCGCGACCTGGGA AGATCTACCCAACCTGGAGAGCAGGAACGAGAACCTGGCGCTCATCCAAA GACTTCCAAGCCTTGGGAGATGGATCTCCATGGGGGCTGAGACGTGGGAG GAGCTGCTTGATGGAACTTGCAGCGTCTCAAACTGCAGCCCAACTCCTGC TACCGAATCAGCCCGCAGTACGAGGCCGACAGCTGCCGGAGCGGAAAGGG AGACGACCAGGCATTATAGGGGCGTGAGGAGGCGGCCATGGGGGAAGTTT GCAGCAGAAATCAGGGACATATCCAGGAAAGGAGCTCGGGTTTGGCTGGG GACGTTCAACACTGCAGAGGAAGCCGCCATAGCATATGACAGAGCTGCGT TGAGGATGAGAGGGCCCCGAGCTCACCTGAACTTTCCACTGGAGACGGCC ATCAGGAGCTCCAAAAGCACTCGCTATGAGCAGCCGTCAACCTGCGCGCT GTGCGACGAGGCATGCTCTGTTTACGGCTGCACCGCAGCAATTCATGAGC GAGCGGATTTGGACGAGGAGCGACCGGCATGTAGAAGAGAAAGGAGCATC GAGGGGATGATCAACAACCGAAGAGATGTGGTGGAGTTGCAAGACCTTGG CACTGACTACTTGGAAAGCTTGTTGTCTCAAGAGTAATGGGGACAGTGAA AAT
back to top

Coding sequence (CDS) from alignment at chrUn_random:113641..114493+

>Ma00_t00090.1 ID=Ma00_t00090.1|Name=Ma00_t00090.1|organism=Musa acuminata|type=CDS|length=816bp|location=Sequence derived from alignment at chrUn_random:113641..114493+ (Musa acuminata)
ATGCTATATAGGCTTCTCTGCGATTCAACTTCACAGCTTCTCTTCAATCC
GAAACGTCTTCTGAGCTCCACAACCCTCATGGAGAAGAAGTCTGAATCAA
ACCAGATGCTGCTCGAGAACGTATGGGCCAGCTTCATCAATGGCAGTCAC
CGACCAGCCATTGGATCCGCGACCTGGGAAGATCTACCCAACCTGGAGAG
CAGGAACGAGAACCTGGCGCTCATCCAAAGACTTCCAAGCCTTGGGAGAT
GGATCTCCATGGGGGCTGAGACGTGGGAGGAGCTGCTTGATGGAACTTGC
AGCGTCTCAAACTGCAGCCCAACTCCTGCTACCGAATCAGCCCGCAGTAC
GAGGCCGACAGCTGCCGGAGCGGAAAGGGAGACGACCAGGCATTATAGGG
GCGTGAGGAGGCGGCCATGGGGGAAGTTTGCAGCAGAAATCAGGGACATA
TCCAGGAAAGGAGCTCGGGTTTGGCTGGGGACGTTCAACACTGCAGAGGA
AGCCGCCATAGCATATGACAGAGCTGCGTTGAGGATGAGAGGGCCCCGAG
CTCACCTGAACTTTCCACTGGAGACGGCCATCAGGAGCTCCAAAAGCACT
CGCTATGAGCAGCCGTCAACCTGCGCGCTGTGCGACGAGGCATGCTCTGT
TTACGGCTGCACCGCAGCAATTCATGAGCGAGCGGATTTGGACGAGGAGC
GACCGGCATGTAGAAGAGAAAGGAGCATCGAGGGGATGATCAACAACCGA
AGAGATGTGGTGGAGTTGCAAGACCTTGGCACTGACTACTTGGAAAGCTT
GTTGTCTCAAGAGTAA
back to top
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g00090Ma00_g00090Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p00090.1Ma00_p00090.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2006433auto2006433Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2006434auto2006434Musa acuminataexon