Overview
NameMa00_t00070.1
Unique NameMa00_t00070.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length1335
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:80753..82327 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
OriginCIRAD:GSMUA_AchrUn_randomT17970_001
Old locus tagGSMUA_AchrUn_randomG17970_001
NotePutative UDP-glycosyltransferase 73B4
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t00070.1 ID=Ma00_t00070.1|Name=Ma00_t00070.1|organism=Musa acuminata|type=mRNA|length=1335bp
ATGGGCTCGGTAGAGGCACCGCCCGCCCCCCTCCGTGTATTCTTCATCCC
CTTCTTCGCCACCGGGCACATGATCCCCTTGGTTGACATCGCCCGCCTCT
TCGCTGCCCGAGGCGTTGACTCCACCGTCCTCGTCACCCCCGCCAATGCC
GCCCTCATCCAAGCCACCGTCGACGCTGCTGCCGACTCTGGCCTCCCTAT
CCGCACCCTCATCTATCCCTTCCCCTCGTCAGAGTCCGGCCTACCCCCCG
GCGTCGAGAACATCAGCGCCCTTCCCCCCTCCGAGTCCTACAAGATCGAC
GTCGCCACCCCCTTCGTCCGCCCCGCTCACGACCGCCTCCTCCGCCTTCA
CCGCCCCGACGCCGTCGTCGCCGACGTCCACTTCCCCTGGACCACCTTCG
TCGCGCGGGATCTCGGCGTCCCGAGGTTCACCTTCCAGGCCCTCGGCCTC
TTCCCCGTGTGCATGATGAACTCGCTCTTCACCAACCTCCCGCACCTCGC
CGTCGCCGGCGACGACGTACCTTTCCTCGTGCCCAACCTCCCACACCCCA
TCCACATGTCCGGGAGCCTCGGCGTCGTCGTTAACAGCTTCGTCGAGATG
GAGTCGGCCTACGCCGAGTACTACTACAAGACATGCAACATGCGGAGCTG
GTTCGTGGGACCCGTCGCGCTCGCCGCCGCGGGTCAGGGCAGCAGCCTTG
CCACACGCGGCGGCGACGATCCGATCGCCGCCGCGAACCGCGCCCGCTGC
CTCTTGTGGTTGGACGCGAAGGAGCCGAAGTCGGCGGCTGGCCACCCGTT
CCTGTGGGTGGTAAGGGACGGCAGCGACGAGTGGATGCCGGAGGGGTTTG
AACGGCGGGTGGAGGGCCGGGGGCTGGTGGTCCGAGGATGGGCCCCGCAG
GTGGCGATACTGGCGCACGCGGCGGTGGGCGGGTTCGTGACACACTGCGG
GTGGAACTCGGTGCTGGAGGGGGTGAGCGCCGGGCTGCCCATGGTCACGT
GGCCGCTGTCAACGGAGCAGTTCATGAACGAGAAGCTGGTGGTGGGGGTG
CTGCGGGTGGGCGTGAGGGCGGCGGAAGGGCCCGGGAGCACGCTGGAGGA
GGAGAGGGCGGTGGTGGGCGCGGCGGAGTTGGCGAGGGCGGTGGGGTGGG
TGATGGACAGCGGGGAGGAGGCGGAGAGGATGAGGAGGAGGGCGAGGGAG
TACGGGGAGACGGCGCGGGCGGCGGTGAAGGAAGGCGGGTCGTCGCACAA
GGGGCTGAGCGACTTGATAGAGGAGATCCGGGCGTGGCACAGTAACAAGG
ACGTGGCTTGTGACGCTGCAACCCTGAAGGATTAG
back to top

protein sequence of Ma00_p00070.1

>Ma00_p00070.1 ID=Ma00_p00070.1|Name=Ma00_p00070.1|organism=Musa acuminata|type=polypeptide|length=445bp
MGSVEAPPAPLRVFFIPFFATGHMIPLVDIARLFAARGVDSTVLVTPANA
ALIQATVDAAADSGLPIRTLIYPFPSSESGLPPGVENISALPPSESYKID
VATPFVRPAHDRLLRLHRPDAVVADVHFPWTTFVARDLGVPRFTFQALGL
FPVCMMNSLFTNLPHLAVAGDDVPFLVPNLPHPIHMSGSLGVVVNSFVEM
ESAYAEYYYKTCNMRSWFVGPVALAAAGQGSSLATRGGDDPIAAANRARC
LLWLDAKEPKSAAGHPFLWVVRDGSDEWMPEGFERRVEGRGLVVRGWAPQ
VAILAHAAVGGFVTHCGWNSVLEGVSAGLPMVTWPLSTEQFMNEKLVVGV
LRVGVRAAEGPGSTLEEERAVVGAAELARAVGWVMDSGEEAERMRRRARE
YGETARAAVKEGGSSHKGLSDLIEEIRAWHSNKDVACDAATLKD*
back to top

mRNA from alignment at chrUn_random:80753..82327-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t00070.1 ID=Ma00_t00070.1|Name=Ma00_t00070.1|organism=Musa acuminata|type=mRNA|length=1575bp|location=Sequence derived from alignment at chrUn_random:80753..82327- (Musa acuminata)
ATGGGCTCGGTAGAGGCACCGCCCGCCCCCCTCCGTGTATTCTTCATCCC CTTCTTCGCCACCGGGCACATGATCCCCTTGGTTGACATCGCCCGCCTCT TCGCTGCCCGAGGCGTTGACTCCACCGTCCTCGTCACCCCCGCCAATGCC GCCCTCATCCAAGCCACCGTCGACGCTGCTGCCGACTCTGGCCTCCCTAT CCGCACCCTCATCTATCCCTTCCCCTCGTCAGAGTCCGGCCTACCCCCCG GCGTCGAGAACATCAGCGCCCTTCCCCCCTCCGAGTCCTACAAGATCGAC GTCGCCACCCCCTTCGTCCGCCCCGCTCACGACCGCCTCCTCCGCCTTCA CCGCCCCGACGCCGTCGTCGCCGACGTCCACTTCCCCTGGACCACCTTCG TCGCGCGGGATCTCGGCGTCCCGAGGTTCACCTTCCAGGCCCTCGGCCTC TTCCCCGTGTGCATGATGAACTCGCTCTTCACCAACCTCCCGCACCTCGC CGTCGCCGGCGACGACGTACCTTTCCTCGTGCCCAACCTCCCACACCCCA TCCACATGGTCCGTCGGGAGCTCCCTGACTTCCTCCGCGGAAACACCCAA ATCGGCGCCGCCATGGACGACATCAGTGCCGCGGAGTCCGGGAGCCTCGG CGTCGTCGTTAACAGCTTCGTCGAGATGGAGTCGGCCTACGCCGAGTACT ACTACAAGACATGCAACATGCGGAGCTGGTTCGTGGGACCCGTCGCGCTC GCCGCCGCGGGTCAGGGCAGCAGCCTTGCCACACGCGGCGGCGACGATCC GATCGCCGCCGCGAACCGCGCCCGCTGCCTCTTGTGGTTGGACGCGAAGG AGCCGAAGTCGGTGGTGTACGTTTGCTTCGGGAGCTGGAGCCAGTTCACT GGAGAGCAGCTCCGGGAGATGGCTCTGGGCCTTGAGGCGGCTGGCCACCC GTTCCTGTGGGTGGTAAGGGACGGCAGCGACGAGTGGATGCCGGAGGGGT TTGAACGGCGGGTGGAGGGCCGGGGGCTGGTGGTCCGAGGATGGGCCCCG CAGGTGGCGATACTGGCGCACGCGGCGGTGGGCGGGTTCGTGACACACTG CGGGTGGAACTCGGTGCTGGAGGGGGTGAGCGCCGGGCTGCCCATGGTCA CGTGGCCGCTGTCAACGGAGCAGTTCATGAACGAGAAGCTGGTGGTGGGG GTGCTGCGGGTGGGCGTGAGGGCGGCGGAAGGGCCCGGGAGCACGCTGGA GGAGGAGAGGGCGGTGGTGGGCGCGGCGGAGTTGGCGAGGGCGGTGGGGT GGGTGATGGACAGCGGGGAGGAGGCGGAGAGGATGAGGAGGAGGGCGAGG GAGTACGGGGAGACGGCGCGGGCGGCGGTGAAGGAAGGCGGGTCGTCGCA CAAGGGGCTGAGCGACTTGATAGAGGAGATCCGGGCGTGGCACAGTAACA AGGACGTGGCTTGTGACGCTGCAACCCTGAAGGATTAGTGGGATTAAAGA TTGTTGTTGTGGTTCGGAATAATGCAAGCTGGAGTGCTCGTGTTAAATCC TTGTTTCTTAATTGGTTTGAATCGA
back to top

Coding sequence (CDS) from alignment at chrUn_random:80753..82327-

>Ma00_t00070.1 ID=Ma00_t00070.1|Name=Ma00_t00070.1|organism=Musa acuminata|type=CDS|length=1335bp|location=Sequence derived from alignment at chrUn_random:80753..82327- (Musa acuminata)
ATGGGCTCGGTAGAGGCACCGCCCGCCCCCCTCCGTGTATTCTTCATCCC
CTTCTTCGCCACCGGGCACATGATCCCCTTGGTTGACATCGCCCGCCTCT
TCGCTGCCCGAGGCGTTGACTCCACCGTCCTCGTCACCCCCGCCAATGCC
GCCCTCATCCAAGCCACCGTCGACGCTGCTGCCGACTCTGGCCTCCCTAT
CCGCACCCTCATCTATCCCTTCCCCTCGTCAGAGTCCGGCCTACCCCCCG
GCGTCGAGAACATCAGCGCCCTTCCCCCCTCCGAGTCCTACAAGATCGAC
GTCGCCACCCCCTTCGTCCGCCCCGCTCACGACCGCCTCCTCCGCCTTCA
CCGCCCCGACGCCGTCGTCGCCGACGTCCACTTCCCCTGGACCACCTTCG
TCGCGCGGGATCTCGGCGTCCCGAGGTTCACCTTCCAGGCCCTCGGCCTC
TTCCCCGTGTGCATGATGAACTCGCTCTTCACCAACCTCCCGCACCTCGC
CGTCGCCGGCGACGACGTACCTTTCCTCGTGCCCAACCTCCCACACCCCA
TCCACATGTCCGGGAGCCTCGGCGTCGTCGTTAACAGCTTCGTCGAGATG
GAGTCGGCCTACGCCGAGTACTACTACAAGACATGCAACATGCGGAGCTG
GTTCGTGGGACCCGTCGCGCTCGCCGCCGCGGGTCAGGGCAGCAGCCTTG
CCACACGCGGCGGCGACGATCCGATCGCCGCCGCGAACCGCGCCCGCTGC
CTCTTGTGGTTGGACGCGAAGGAGCCGAAGTCGGCGGCTGGCCACCCGTT
CCTGTGGGTGGTAAGGGACGGCAGCGACGAGTGGATGCCGGAGGGGTTTG
AACGGCGGGTGGAGGGCCGGGGGCTGGTGGTCCGAGGATGGGCCCCGCAG
GTGGCGATACTGGCGCACGCGGCGGTGGGCGGGTTCGTGACACACTGCGG
GTGGAACTCGGTGCTGGAGGGGGTGAGCGCCGGGCTGCCCATGGTCACGT
GGCCGCTGTCAACGGAGCAGTTCATGAACGAGAAGCTGGTGGTGGGGGTG
CTGCGGGTGGGCGTGAGGGCGGCGGAAGGGCCCGGGAGCACGCTGGAGGA
GGAGAGGGCGGTGGTGGGCGCGGCGGAGTTGGCGAGGGCGGTGGGGTGGG
TGATGGACAGCGGGGAGGAGGCGGAGAGGATGAGGAGGAGGGCGAGGGAG
TACGGGGAGACGGCGCGGGCGGCGGTGAAGGAAGGCGGGTCGTCGCACAA
GGGGCTGAGCGACTTGATAGAGGAGATCCGGGCGTGGCACAGTAACAAGG
ACGTGGCTTGTGACGCTGCAACCCTGAAGGATTAG
back to top
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g00070Ma00_g00070Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p00070.1Ma00_p00070.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2006419auto2006419Musa acuminataCDS
CDS-auto2006420auto2006420Musa acuminataCDS
CDS-auto2006421auto2006421Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2006422auto2006422Musa acuminataexon
exon-auto2006423auto2006423Musa acuminataexon
exon-auto2006424auto2006424Musa acuminataexon