Overview
NameMa00_t00060.1
Unique NameMa00_t00060.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length186
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:54493..54678 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteUncharacterized protein
OriginCIRAD:GSMUA_AchrUn_randomT17960_001
Old locus tagGSMUA_AchrUn_randomG17960_001
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g00060Ma00_g00060Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p00060.1Ma00_p00060.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2006414auto2006414Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2006415auto2006415Musa acuminataexon


Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t00060.1 ID=Ma00_t00060.1|Name=Ma00_t00060.1|organism=Musa acuminata|type=mRNA|length=186bp
ATGCGCACAAGCTGTTCATACTCTGACCACCCAACCCCATCCCATCCCTC
TAGGTTTCCCATTTTTGAGAGATGCCTTGTTTTGTTCTTCTTCAAGCTGG
CTTGGCATGTAGATTGCAGTTGCTTGCAGAGAACAAGTGACTACTACTCT
TTGTATGCTTCGGATGTTACGAACATAGAGGCTTGA
back to top

protein sequence of Ma00_p00060.1

>Ma00_p00060.1 ID=Ma00_p00060.1|Name=Ma00_p00060.1|organism=Musa acuminata|type=polypeptide|length=62bp
MRTSCSYSDHPTPSHPSRFPIFERCLVLFFFKLAWHVDCSCLQRTSDYYS
LYASDVTNIEA*
back to top

mRNA from alignment at chrUn_random:54493..54678-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t00060.1 ID=Ma00_t00060.1|Name=Ma00_t00060.1|organism=Musa acuminata|type=mRNA|length=186bp|location=Sequence derived from alignment at chrUn_random:54493..54678- (Musa acuminata)
ATGCGCACAAGCTGTTCATACTCTGACCACCCAACCCCATCCCATCCCTC TAGGTTTCCCATTTTTGAGAGATGCCTTGTTTTGTTCTTCTTCAAGCTGG CTTGGCATGTAGATTGCAGTTGCTTGCAGAGAACAAGTGACTACTACTCT TTGTATGCTTCGGATGTTACGAACATAGAGGCTTGA
back to top

Coding sequence (CDS) from alignment at chrUn_random:54493..54678-

>Ma00_t00060.1 ID=Ma00_t00060.1|Name=Ma00_t00060.1|organism=Musa acuminata|type=CDS|length=186bp|location=Sequence derived from alignment at chrUn_random:54493..54678- (Musa acuminata)
ATGCGCACAAGCTGTTCATACTCTGACCACCCAACCCCATCCCATCCCTC
TAGGTTTCCCATTTTTGAGAGATGCCTTGTTTTGTTCTTCTTCAAGCTGG
CTTGGCATGTAGATTGCAGTTGCTTGCAGAGAACAAGTGACTACTACTCT
TTGTATGCTTCGGATGTTACGAACATAGAGGCTTGA
back to top