Overview
NameMa00_t00040.1
Unique NameMa00_t00040.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length1083
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:33450..52408 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NotePutative Tobamovirus multiplication protein 1
OriginRefSeq:rna43952
Old locus tagGSMUA_AchrUn_randomG17940_001
Old locus taggene32599
Previous locationchrUn_random:84871589..84890547
Cross References
External references for this mRNA
DatabaseAccession
GeneID103974354
GenbankXM_009389160.1
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t00040.1 ID=Ma00_t00040.1|Name=Ma00_t00040.1|organism=Musa acuminata|type=mRNA|length=1083bp
ATGCGGACCGAGGGTGGGGCGGGGCACAGGTGCCTGCCGACCGAAGTCGT
GGCGGCAGATGCCGCCCTGGCGGTCGTCGACGGGGCCCTGGCGGTCGTCG
CTTTCTTGCAGTTGTTGAGAATTCACTTACGCAACCAACAACTTGGCTGG
ACTCGCCAAAAGATATTCCATCTCATGATTGGTTCATCCAACATCGGCTA
CTTGGTGTACTTTATTTTTACTATTGTTGCTACTTGTGAGGGATGGCAGT
GTTGGTCACATGGCTGTGGGTTTATCCTCATGGCTTGTCCTCAGATTCTG
TTTCTAGCTGCTTTCCTTCTGCTTGTGTCTTTCTGGATTGACCTATGCCA
TCAGGCAAACGATGATGAAGAAGATGATGATGAACATGGATATAATGAAG
CTTTATTGGAAAAGTCAAAGAGCAAACAAGGTTCACCACATGTTGATGGC
CATATGAAATGTTGCTTTCCTCGAACCATTCATATTGGAAGTCGACAAAA
GTTTGTAATCTTGGTGATTGTCCTGACATTTGTTTCGGTGATTTCTTTTT
CCATCCTGATATGGATTGGTAGAGGAAAAACTCCTATCGATTCTTCTCTT
GTGGCTTGGGTTTCTTTGGATATTTTTTCTGTAGCTATACTCCTACTAGG
TGGTGCTTTAGCATGCTATGGGGTGCTGTTGTTCTCAAAAATGAGCAAAG
TACGATCTGAAATGGCTTCAAATGATATGTGGAAGGTTGCAAGTTTGGCT
GCTGTCTCTGTTACATGTTTCACATCATCTGCTGTGCTAGCTCTTGTTAC
TAATATTCCTCTGGAGGTGCTTTTTTATTGGCATGCAGCACAATCAGACC
ACATAAGCAGTTCAGTTCTTATATTTCTGTATTATTTTATAGGTTCATCA
GTACCATCCGGATTTGTCTTGTGGGTTATGAGAGAAATGCCTCCTCGGCT
TGTGGCTGATAGTCATAGACCAGCACGGCCTACGGTCGTAAATTTTATCA
GTGAAAGAACTACTCAAAATCCACAATGGAGGGCTACGGTAACATCCTCA
CAGAATAAGGGTCTGAAATCAAGCCCAATATAA
back to top

protein sequence of Ma00_p00040.1

>Ma00_p00040.1 ID=Ma00_p00040.1|Name=Ma00_p00040.1|organism=Musa acuminata|type=polypeptide|length=361bp
MRTEGGAGHRCLPTEVVAADAALAVVDGALAVVAFLQLLRIHLRNQQLGW
TRQKIFHLMIGSSNIGYLVYFIFTIVATCEGWQCWSHGCGFILMACPQIL
FLAAFLLLVSFWIDLCHQANDDEEDDDEHGYNEALLEKSKSKQGSPHVDG
HMKCCFPRTIHIGSRQKFVILVIVLTFVSVISFSILIWIGRGKTPIDSSL
VAWVSLDIFSVAILLLGGALACYGVLLFSKMSKVRSEMASNDMWKVASLA
AVSVTCFTSSAVLALVTNIPLEVLFYWHAAQSDHISSSVLIFLYYFIGSS
VPSGFVLWVMREMPPRLVADSHRPARPTVVNFISERTTQNPQWRATVTSS
QNKGLKSSPI*
back to top

mRNA from alignment at chrUn_random:33450..52408+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t00040.1 ID=Ma00_t00040.1|Name=Ma00_t00040.1|organism=Musa acuminata|type=mRNA|length=18959bp|location=Sequence derived from alignment at chrUn_random:33450..52408+ (Musa acuminata)
ATTGCCGTTGAGCGCATCCGACGACGACAATAGCTCTCCTCCTCCATCAG CCACCTTCTTCCCCCACCTTGTGTTTTGACGCCGGCAAATCTCTCTCTCT CTCTCTCTGTGCAAACCCTAGTCGGCGATAGTTCTTGAATCTGGGCAATA AGGTTGAGGGAGCAAAAATCTTCCCTACCGATCCGTTTCCGGAGCGGGCG AGGGGGATGCGGACCGAGGGTGGGGCGGGGCACAGGTGCCTGCCGACCGA AGTCGTGGCGGCAGATGCCGCCCTGGCGGTCGTCGACGGGGCCCTGGCGG TCGTCGCTTTCTTGCAGGTTGGTCCCCCTTGGTCCTGGAGTTCGTTTCCC TCATTTCTGCTCTCGCTGTTTGCTTAAAGAACTCGCTCTATTTCCAAATG ACCAGCTATTTCCTTTATGGAATCCTTGATGTGCCTCGCCGGTGTTCTTT ATCTTGCATCGATTGGGAATCTTGGGTATATGCAGTGCCAATTACAGTTA TCTTTTCTTACGCATTGCGGGCTGTGTTTGCAGTCATAAATTTGTTATGG TTCAATAGACCAAATGGGCATCATTCTAAGACATCAAGACATTTGTGGAC ATCGCCATTCTCGGTAGACTTGATGCTTGAAGAGCCCATAATAGGTCGAG AACCATACGTTGTAGCTTATATTATCTGTTGGTAGCTAAAGATATTCCGT CTTATTAAAATTATAATTTTCAGCGCTTTGCAATTCTTAAAATTATTTAT TTTTAGAACTATGTGAACTTGATGTATTATTCAAGTTTTTCAATTTGATC TTCAAAATAAATTTTACTTTATAAATTCAAATGCTTCATATAATATTGCT CAATCATCTTTTTGATATATAAAAATATTAACATAATATAGTATCTTTTT TATCATTATGATAATAATATAACTTATATCATATTAATTTATATAGTAAA TTTTTTAACAAGAAGAATGAAACTAAACACATTTTGGGTTTCTTTTTCTT CCTTTGTGGTTTCATTTGTTATGCTTGATGATTTGTAAACTGACTCAATG ATTAGTTCTGAAAATTCTTCGAAAAATTAGTTGAGCCAAACAACACGCAC CCCTATCGCTCACCAATAGCATAGGCTCATCGTTTCAGTGCATGCACCCT GACCACATAGTCCAGTTGTATTGCATACTACTGTAGGGGAAGAAATGGGG GAGAGGAAGACAGAGAGGAGGAGAAATTTGGAGAGGTATTCCACTCTTCT TCATGCTAGGTGTGTTTTCAATGGGTTGTTATGCACCTGGTTTTCCATGA AAGGGAGGGGAGGAAAGGGCAGATATGATTTATTGTGGTGGATGGTGCTT ATGATGGTGGAAATGGTAATTAGAGGTAAAGGGTGTCAGGTGGTGCAAGG AGAAGTGAACTGGAGTGCGAGGACTGAGATTGTAGAGTGCAGTTGATGTG TCATCTAGGTAGTAAGATGTGATGAAGGTGATGATTAGGCTGTGTGGGAG GTGGTATGATGAGATGGGAAGCAAGGGCAATGGGACAAAGTGACCAGAAA GTGGAGTTGCAGACCATTAAAGGGACAAAGGCTTTCGTATTAAGTTCTAG AGCCATTTTTATTCCATGTTGGGTCACTGATACTTAAATGCTTCTTTATA TTATTAATCTTTTCCTTGAGATATTAATTCACTTTTCTCCTGCACTTGCT TCCCAGTTTTTTGGCTCATTTTATCTTGCACCTATTTAGCTCTTATTTAT AATGTGGTCCTTTCATATTTCAAATCTTTAGATATTATGTTTTGCTGAAT GCCTAATGATTAACTAACTAGGAGTTAAGTAGTAGTATCTAATGGTCTTG TAACAGTTTTAGTTTCCTTAATTTATTTTATCTTCTCTAGGTTCCATAAC AAGTTTTGGAATTTTCTTTTCCTTTTGTTTGATTTACCCTTTTTTTCCCT ATATTGTTAGAGCACATTATAAAAATGGTGGTAGGATACATGGTGACCAT TTGAGAAACATGCGTGTCTAGGACCTATAGTTATTGTATTGAAAAAAGTT GAATGCTAGCAGTCATAAAGGATGGGGTTCTTCCATTTTAATTATGGATC TATGGAACTGGAGATAGTTAAGATAATGCTTGTTTTTGTCATTACTTGTA TGGTTAACTTGGAGTGGTGCATTATCTGAGATTGCAGCTAAAATCCAGCC TATTTCAGTATTTTTTCTCTCTGTTTTTCCTCTTAGTGAGCTTTGAGGTG ATTGTAACTAATAATATGTTCCTATGTGATTTTGGGGTATGGGTCTTCAT ATGTTTTTTCATTTTAGTCTTCTTACACCAACTTTTATCGAGTTATGTTG TACATTGATTAGCTTTCTCTTAATGGCAGTTGTTGAGAATTCACTTACGC AACCAACAACTTGGCTGGACTCGCCAAAAGGTATGCGGAAAACAGCCTCG AGTTGTTCAGTGTAAATACATTATCTTCTTTATTTGTTTAAGTATGAAAT CCATCTGCAAGTAGCATCTTAATATTATGTTATTTGTTCTGCTTTAATTA TTTCTTATACTTATTTTGATTATCAGTTTTAAAATACAAACGATGAATAT ATAACCTATGTATTTGTCATATTTCCTTGAGATGCTTAAATTATTTACTG TGCAGTCAGTCAGTCTAGCTGCTACTTAATTTTAGTTTGGTTCTTACTTC ATGCAGTGATGCAGGTGGTTGCACACACCTTTCTGATATTTCATTATTCA CCAGTTGTGAAATAAGGCTTTAAATAAACCATGATTTCAGGAGAACTTTT CTTAGTATGAAGCTTATTTAGCCACTTGATTTTGTAAGATCCATTTTACT GTCCACCTTAGGTAAATTGGAAGTAGAGCACAGCCAAATAGAGATTAGCA AACTCAAGCAATATGTTTCAGTATGTACTTACTGGATCATATACAATCAC CTCTTTGAGGTTCTCAGGCAAAACCTGTCATCTTTGTCGTGCTTCTGAGG TTCTCGGGCAAAACCTATCATCTTTGTCATGCATAGACAACCTTGCTGTT AGTCGAATCCATATCTTGGCCCAGCTTTACATAATGTTATATCTTGTATG GAATTAGCTATCTACCTTCTGTCTTGGTTAATGATATATATTAGGCTTTT AGCCATTACTTCTGGTAAGTAGTCACTAGTGTATTGTAGTTATCAAGCAA GAAAGGAAAGCATAATCTCCTTGCTTGACTGCTTGTCTCAAAGTGGACAG AAATATCAATTCTTTTGTAGCAAGATGATATATGACTCGGTTTGTCTCTG ATAAATTTACTATCCTCTTCGATTACCTTGGTCCTTTTTTTCATCTTGCT ACTTTTACCTTCTAAGTTATATCTGTATGACTTATCATCTACAAATAACA AGTTTTCCAGAAAAAAAAATTATCACCCTTGACTATTCCATTTAAGCTTT GAATGTCAAGTAGATCTTTTTTGCTAAAAGCAAAACTCTATATGCTAAAT AAGTTACAGCTGCCACATATCATGATCTGGGAGTTATTTATAACCTTCTA GGACTATTTTAGTTATCCTGAATTTTGCATCATGCAGTATATGGAGGCCT TCAACTACTCCAAGTGTGCTTAAGGAGGTTATTTTCTTAAATCAGTGTCT ATCCTGTTGGATTTTTTTTCCCTGGACAATGATTCTTCACTTTATTAATT ACATGATTACACCTATTCCAGATGTGCAAGAACTTCAACATGAAATGTTG CTGCCTATAATATAAATCTTGTGATTGTTCTATCACCTAATTGCTCTTAT TTCTGTACCTAGAATAAGAATGCATGTCACATCAAAAATCTCTACTTAGT AGGACTTTTGGCACAAGGTGCAAGCTCTTCTTGGGGGCTAGGCTTAGCTT TTTCTCCTCCTGAAGAGTAATTTACTTCTCCTGCATTTCCTATGCCAATT GATATAGATCTAGTCTCCTGTTCTCCCAATATTAATTACTCGAGAATATG AAGGGCTAAGTTCTTACTTTTAAGTTTTAAGAATGTGTACCATCATATTT AAACAATGTCATACAGTATTGTACACCAACACTAGAATAATTTGATTCTG GTTTTTTTAACAGATCTTTTTTAATGTCTAGATCATAGGTCTGCTGACCT TGATTTGTTTGAACAAAATCCATTTCATATTGCTATGCTATTTGTTTCAG CCTGTTTAATTGTGCCATTGATTAGTTCTGTGAATGTCTAATTTCTTGCA GATATTCCATCTCATGATTGGTTCATCCAACATCGGTGAGACACCTAAAA TATGAACAGTATCTACTTATGGCGCTAAGTAATCTTGAATTTGACTGTTG TTCAACTTTAATCTCATGATCTCATTGTTCAAACACCACAAATTCTAGGT TCAATGTTAAGATTCTGCAACCTATTAACAGTATGCATAACATCAGTTAC TTAGTAACACTTACAAAACCATGTCATAATCTGATTCTTTGATGTTGGCA CTTTTTATAGTGGTCTTGGATGAACTTTTGAGATTTAGCATAAAATAAGT TATGACCAATTAATGCTTGTCTAATTGACTTTTTTCCCTTTTGTACATTG TTTACAACTACAAAATTGACATTCAGTGATAAATCTAGTGTTGGAAATAT ATCTGTCTGTGTTTTTCTTCAAATATGATTTCTCATGGGGTAAACTAGAT GGTACCACAATTTGCTGATGCATGGATTTTGCTTGTTATATAAAGTGACA CATCATAAGCTGACGTCTATTAAAGCCATAATCTAGGGTATCTTGTTTGG TCCATTAAAAGCTAGCATTAATGATGATTGCACCTGCCAGACATGACAGT TTTCTTGATTATGAAGAAGTTTTACTACTTTACACATGGTAGCAGCATAG CTTAAAGCCCAATATAGTGTTAGGCGGCAACTAACACCAATTATTACAAG CAATGGTCAAGTGAAACTGAATTAAAATCAAAAGACCATTTGAGGTTGTT CAGGAAAAAATTGGCGAAGTGAAGCATTTAATTTTCTTCGGTAAGAAGAA TTTATATCAACAATAGTATGAACTCTAGCACAATCTTTTGTCATGTTAAG AAGAATGAACTCTAGCACAATCTTTTGTCATGTTAAGAAGAATTTATATC AACAATAACACTTTAAGATATGTGGATCAAGATTTTAAAAACTGATTTTA CTGATCTGATAGTTGAGTAGTATGCAGACCAAACAATTTGACTCAGTCTG ATCCATAAACAAGCTTATTGTGCAGTCAGCTTACTGGAATGAGCTCATCA AATGGTGAGTTGATATGTATTGAGTTGTATTTGGTGGTAAGTCTATCATC TGGTATTGGTACCTGCCGTATCCTACATTTTTCCTCTCTTCCTTTTCATC GTCTTCTGTTAATACTGCTCCACTCCTCCCAGGCTCCATTTGTTGAGCCT TCTCTTATACCTCCTCCTCTTCCTCTCTCTCTCTCTCTCTCTCTCTCTCT CTCCCCCTCTAGTTGTAGTGGTCTAGCCAGTGTGATAGTTTGGCCACCGA CCAGTATTGGTACCAAACTGAGATTCCTTTTGTTCAAATGGAAGATAATT GTGCCATCATAACTAAATGGTGGCCACATAAGCTGGTCCACTTAATATGC ACCTTTATTACCTAGCAGCTTTTTTTTTGTCCACAGGTCTTAATCCAAAT GATTCCTTGTCATTTTCTTTCAACTTGTAGAAGACCTCAGCATGCATTTT TTGTTGAAGTGTGAAGTCAAACCATTGTCTCGAGCGTGAAGGTTATTTCC ATGAAAAGTGTTTTTCCTGCTATTTGAAGTTCTCCTGCTTATTCTGCTAC ATGTTATGGAGCTTCTGATAATTTTCATATGATAGTTCCAGTATATTATT ATTTTATTTGTTCTAATATATTTTGTCAACTATTCATAAAAATGATTCAT TTTGCCACACTTAAATGATATATGTTAATCATATAGCAGGCTACTTGGTG TACTTTATTTTTACTATTGTTGCTACTTGTGAGGGATGGCAGTGTTGGTC ACATGGCTGTGGGTTTATCCTCATGGGTAAGCACAATTTTAATAAAAGTT ACTTCAGTTGGCTTCTTCAAATTCTACTGTACATTCAACTCTGATGCTAG TTTTTAAATTGGTTAAAAGTTAAAAACTATTTTGCAGCTTGTCCTCAGAT TCTGTTTCTAGCTGCTTTCCTTCTGCTTGTGTCTTTCTGGTGAGTAACTT ATCTTCTTTGTTTCTGAGATATAACTAAGGCATTTCACAAGTTCCTGAAA TATTTGATTTAAAATAGTGCTTAAAGATTCTACTTGTGGCATACTTTGTA TGTATTAATTGGTAGAACCTTTTTTGATGTTTAAAGATGCATTTTTTACC AATATATTGATTTGATGAAGTTATTTTCGTTGAGCATCAGACGAATTTGT CTTAGTTTTTAATAAGTTAAATCACCTTATTTTAGAACATTATGTTATTA GAAATGCACACAAACTGCTTGTTGTTGTTCTTCATGTTTTATTATCGTGT ATTCTTTGACTTATAGGAATTGTCTATGCTGGTCAGAAACGCATTATATT TATTTAAAGTACATTTCATTGTCATATCCATGTCTTAACATTTTCTTTCT TTTTCTCAAATTTCACCATATTAGATATCTATAATTCCATATCATATTAT TGTGTATTCCTTGACTTCTAGGAATTGTCTATGATGGTCAGAAACACAAT ATATTTATTTAAAATACATTTCATTGTCATATCTGTGCCTTAACAATTTC TTTCCTTTTTTCAAATTTCACCATATTAGATATCTATAATTTCATGTCCT ATTGTATCAGTATCATGTCAGAGTCCATGTTTCATAGCCATCATATCCTG GTTGACACAAAATGCTGATATCTCTAGAATCTCATTGTCTCAGCTGTCAC ATGTATACTGCTCATCTTAATTTGTTTGTAGCAAACTGTAATTTACACCC TTTTGAAAGCTGATGCCAATCACATAAGTTCTCTAACCAAAAGAATTAGC TAACAAAACTTCTGATTTCTTATGGAAGTTTGCATTTTTTTGATATAGAA TTTCTTATCCCAACTAATCTTTTTTATTGATTTATGCATTTGTTGTATGG CAAATGATATTGATTTAGGCTGTATACAAAGTAAAAAATATTTTTTTTCG TTAATTTATTTTACCCACATAAGATATACCTTGTTAAGTACATTAATATA TGGCCCTTGGATCTGTCTAATGTTTCCTAAATTTTTACCGTCTTCCTGTG AAATGCTAGTTGTATCTGTCTACTAATGAATTTAATTAAAAATTGTTTTA AGGATATAATCCACAGAAATCTCTATTTAAGTAGTGTCAGCTATACACTT TTAGACCTTGGCTACCTATGTTTTAGCTGCCTTCTAAAAATTATACTATG GAGCAACTTACATAAAGTCCATCTGTAAGCTTCGTCTAGGTTTGGAGGAA CTCATAGGAAGTCCATTTGTAAACTATGTTTGCATTCTTGTAAAAAGTAA AAAAGGAGAATCTGTAAGATTATAGTTTGGTAAGTGTTTTTGAAAAATTG CTTTTACAGGATTGACCTATGCCATCAGGCAAACGATGATGAAGAAGATG ATGATGAACATGGATATAATGAAGCTTTATTGGAAAAGTCAAAGAGCAAA CAAGGTTCACCACATGTTGATGGCCATATGAAATGTTGCTTTCCTCGAAC CATTCATATTGGAAGTCGACAAAAGTTTGTAATCTTGGTAATTGAATGTT GGGCATGCCAACTAATCATATCTTCACATGTTTATTGGAGTAAATTTTAT AGATTCCTTGGAAATATTCTGGTTTTTCTTCTGAAACATTCTGAAGTTTG ATAACATAATATCACACTAACGAAATAAATGGATGTCACACCTTATTTTT GCAGGTGATTGTCCTGACATTTGTTTCGGTGATTTCTTTTTCCATCCTGA TATGGATTGGTAGAGGAAAAACTCCTATCGATTCTTCTCTTGTGGCTTGG GTATGTAATTGGCTTTACCGACTTTTCGGACATTCTTTATCGCTTAATTT TTGGACCAAATCCAACTATCTCGAGTTATCTCCAATTGTTATTATCTTTT CTTATCACCTTGTCTTCATATCTCATGATTAATATGCCACCAAAATAAGG ATAATTTGGGACTTTCAGCTGTCATTAGTTAAATTCAATTATTTTGTAGA ACAACAGTTAATGCTAGGCATAACGTCAACTACATCTGGGACCCTACTCT CAAAATACCCGGAATAAATTAAAAACCTAGTTGCCAAAAACATACTGTTT ATTGTACCAACTTTTCCTGACCTTATGCACTAGAGCGTGGAGCGTGTGGA AACTGGCTTATCAAAGAGAATTAGCTTCTCTCTGAAAACTGTGTTTGTAA CAAGCTTTGAGTTGATCTCTTCTTTGCCTCATTTGAAATATATCTGCTAT GGGCAGACCTAATAAAATTTGAAGTTTTTTTCTGTGAGGAAATTTGGGTG CATTGAAGATAGGACAAATTCTGCAATATGTCAATATCTGGGGTCTGAGC TCACCAAGGATTAAGAGCACTCATTGTTCCTCTCATGTGATTTGCATAGT TGACTGATATCTTAAGGACCCTCAACCATCTTTGCTTGATCTATTTTATG AGATACTTCTATCTACTAATAGGAGATGTGCTTTATGAGATACTTTTTGG AGCATTAACTACTAATGGGAGATGTGCTTTATGCTTTGCTGGAGAACTTT CTTTGTTTTGTTGTACTTGATCATTCTTTGTATCCTCTTGGAGGGTAGAT TTTACTTCTTACCATACCACAAGTCCTCAATTAAGTGGAAATTGGATCAC CAAGTTTAGGTTAGCTGGGAGATATGTTCTGCCTCAAGTAAGAGTATCTA GTGTAGTTCCCCAGTTTGCACGATAGTACGTGCAGTATGACACTTGCACT TTCTATGTTGAATGTAGATCCGGCTCCGCGGGCTATGTGAATGCCCCTCA ATTAGCTAGATGTGGTCTTGGTAGGCATGGATGTATCTTTTACCAGACTT ATGATCTAGGGTAACCTTTGGATAGGTCATGTGTCCTTGTTGCATGGCTT GTGTCCCTGCTTCAGATATATGTGTATATCATAGTAAACACAGTTTTTGT ATGTTCATGTCTATGAATATACATATAACTTTATAAGTCTTTGGGTTTGT GTCTAAATTTAAAATATCTTAGCACTGATAATGTATCCTGAAAGGTCCAC AAGAAATTTCAACAAGTTATGCTCAATCTTGAGTAGATGGATTGGATATC TCATTCAACATTGTGTCTGATAACTTGGTACATGAATGGAAAAGAAGTGC CAACACAACCTACTATTTTCATTTCTCTTATTCATATTATAGTTCTCACT AGTTTGTTAAGTTTAATGCTGTTCACCAGCATGATCTGATGAATTTCCAG TCCCTCTTGGGTTTGCTTTACATGGAAATATATAAAATATATTTTTTTTT CTGTTTTTCATTTGCAGGTTTCTTTGGATATTTTTTCTGTAGCTATACTC CTACTAGGTGGTGCTTTAGCATGCTATGGTAAGCATCGTTTGATATGTTA ACTATTGACTAGTTTAACCAATTAGGTTAGACCAGGCTCTTTTAATATCT CGAAAGTTATGAAACACATCTCATGTATATGTATGAGCTGCATCCATTAT CCATGCCATCACCAATAACAACAAAGCCGTAAGGCATTATCAACATTACT AATAAGAAAACAGTTAGAGGGAATGGTGCCTATAGTTGCATTCTTCATCA TCCAGAACATAAATGAGATCCAAACTCAAGGTACATGCTTGTCACCTGTA TAGTAAATTAGCTTGCTAAAACTTTCTTTTAAAGATTACTAAATTGTGAA GATAAATATAGTTTTTTTTTATGCAATTCAACTCAAAGGGTTTGAGTGAG TCAAGCCTATGTTGAGTAGTGGCAAGTTGAACAGATCCAAGTCATTTTTC TAAGCTTTTGGTATTTTGTTCTGATTTTTTATTTCATCGTTAGAGAAGTT GTCGTTAGAAAAAGTTGTAAAGTGACAATTTTTTTTGGAGTTCTACTAGG AAAAAGGTATAGAGTCCAAGGATGTGTCTAGATTCATCATGTTTAATGTC TTAGTGAGAAAGTTCACCATAGCAGAAAATGATAGACCTAAGTTGTACTC ATCTTTTCCTATCGATTTCTAGCAAACAAAACATCTCCAATGCTGGATTT CTTTCACTGGACAGAACTGAAAATTGCATTCATTCTTTACAATATTGGCC TGTAAATTGGGACCTATGAACTGAAGTAAAATTGAATGTTTTCCTGGCCC TAATAGTAATGCCTTAGTTTCTGACAAATTTCTAAGCTGGAATCAGTCAT GAGTGGTCAGATTATTTGGGTGCAGTTATCCTGTAAGAGACAAGGTGAGC TTGTTATTTTGAAATTTACTCTGGTCAAGAAAGTGGAAAATCTGTGTAGT CTCTCTGGCCAAACACCGAGTGATGCCAGCTGTTTCTGTTGACAGCCACA TCTTCTGGATGTCACCACCTCGTAATTAGGCAATTTTAATTATAATTTAT CTTGTTAAAGAAAGTAATAAATCTGTCTAGTGACAGATTGTTTCAGATGG CACAAAGTGCAGGGGTATGTGCACTTGACTTGAGCAAATTCTTCATATAT TATTATAATGTCACACATTGTACGTGTGACAAGTTTTTAAAGGAGAGCAT GATAGGACCCTAGCAGGGTTGGGTCCTACTCAACTAAGAAGCAGCTAATA AAAACCCTGTGAGATTGTAATAAACCCCACCTAGCCGCCTCTATCCTATA AAGAAGAGTGGCTAGGGTTTATTTTGGGCCTTTGGGCTTCCTAGCCACCG CCCCCCTTTTACTGGGCTGGTCGACTAGGATTGAGGGTAAAAGGGGTAAC TCACTTAGGAAGCAGCCCCTAGGGCTAGGGTTTGGAGCCCTATATAAGCA TGTAGCCTCCATCTCTTTGGGAACAAGATTTATCTACAATTGCAGCCATT TGGCTGACTTCTAGGAGGGTGGAACCCCTATACCGTTTCAAGGGTTGATC CCCCTCAAAGATCAATCTACATATAATTCCTCTGGGGTTCTATCATCTGG TATCAGAGTAGCGATCTTGTTGCTTTTGCTGCCAACCCTGCCGCCCACTA CCAGCCAAGCAATTCCCACAATTGCTCTTGACGTCGTCATCTCCATCATC ATCTTCTGCTGTAGATCAAATCAATCTACTGCCGTCACCTCCAATTGCAT CAGAGATGTGTTATTCTCCTATCACCAATAACTTTTGTTGTTGTAATTTT CCATTCAAAATACCAAGAAGTCTTTTTATCTATCCCGTGCTGCGAATTCC TTTCGTCGTAAAAGTTATCATCTTTGTGAACGAAGGATTGCTGCAGAAAA TTTTAGTCGCATATTGTTGCCTTTAACCGATCTATTTGCTATCCTTTTTG AACGAAATTTCTTATACGCTTCATAGATCGTCTTGGCTTTCATCTAAGAG TGATCTATTGAGGAATTCATCTCTAAAACGTTCTTGTATTGTTGCAAATT TTCGTTGCAAACCGTTGGAATTTTTCAACAAGAATTTTGCTATCGCAACT TGCACCGATTTCCTTGCTGTTATACTGCCAAAATCTTCTTGATCAAATTT GTCATCATTGTTGTTATCTAAATTGAGATTTTGTTGTTAAATTCCCTCCT CAAATCTCTCAATTTTAGCTGAAAATTTCGTTGTGAAACCGTTGTTTCTT CGATGACAATTCTACTCTTACATACACCAATCCACCAACCCTTTCGGCCA CCACTTCTCTCAACTGATACATGCCTCTAACCCGACAACAAAAGAGAGAT CTTAACGTTACAAATTTGGAGGCATATACTATGACATCTGAGGAGACAAT CAATGCTAAATTTGAAGCTTTCGAGACGCGAATGAAGGATAAGATTCAGA CTCTCTTTACCAAACTCAATTTGGGCCAACCACCGAGCCTGAAGAAATCA CATCAAGGAGTGAGCTCTGACCGAAGATATGACTTCCAGGAGAGGGGAGG CTCTGTGATCGATCCCTATTATCCACGCATAAGGGTGGACTTCCCTAGAT AGGAAGAAGGAGACCCGATTGGTTGGATCTCGCGCGCGGAACGATATTTT CAGTACCATAAAACCATGGACGCATCTATGGTGGAAATTGCGGCTATACA TCTTTAAGGGGATGCCATATAATGGTTTGATTGGTTTGAACACACTTATT GAGTCCTCTTATGGCGACAATTCAAAGAAGGAGTGCTGATCCGCTTCGGA CCAACCGATTACGAGAACATTGACGGACAACTAGTAAAGATCCGACAAAC CTCCACCATTCAGGAGTACCAAACCAAGTTTGAAAGGTTATCTAATCAAA CTCGTGATTGGTCTGAAAAACAACTATTGGGAACCTTTATTGAGGGCTTA AAGCCGGAGATCTAGGGAGAAGTTAAAGCGCGACAACCGTACACGCTTAT GGCAGCCATCACTTTTGCACGATTTCAAGATGAGTGATTGAACCATATAA CCCGGAGGACTAGGGTCACTCCTCGACCAGCAATACTGAAGCCCTCAGCC CCCCCTATTGTCAACCGAGCCCCTGCACCAAAAAAGTTGATAAGAGAAGA GCTTCGGGAGCGATCTGCGATGGGGTTATGTTGGCATTGCGACGAGCCGT GGAGCCGCGAGCATTGTTGTTAAAAAGGGAGACTTCTTGTGATTGAACCA GTAGAAGAAGAGGTCATTGAACATCCAAAAGAGAGCCTTGAACATAAAGA AGAAGATGCGTAAGAAGAGCCACAATCGATCGACTTTATGGTACACGCGC TAGCTGGCTACTCAAACTCGCAAACGATGAAAGTTGGAGGCCTTCTCAAA CAACAATCGATCACTGTTCTCATCGACACGGGCAGCACTAATAACTTCAT AAACAGTAAGGTTGCTGCTCAGATGGCGCTCCACATCGAAGGTTGCAACA AGTTCGACGTAAAGGTCATTGACGGCAGAATCCTAAAGTGCGATCAAATA TGCCCGCTGGTGAAACTATTACTATAAGACCAAGAAATTGTCTTCGACTT CTTCCTCCTACCAATTGATGATTATGAGGTCGTGCTTGACATAGAATGGC TGGCAACGCTAGGTGATGTCTCTTGGAACTTTTCCAAATTAATTATGAAA TTATACTGCAAAGGCAAACATATTATCCTATGCGGGAAGCGCGGAAGGAA TGTAACCACCGTTTCGACCCAACGAATGGAGAAAGTTCTACACAAGGTAA ATGGTGACATTTTGATGCATCTCCAGTGACAACTAGAGGGGAAGAAAATA TAAATTGAAGATCAAAATCTTGGCCAATTGCTTGCTGAATTTGTTGACAT TTTTGTTGAACCTCGCGGTCTTCCTCCTACTCAGCAACATGGCCATCAGA TTCCAATTCTTCCGGGCAAACCACCAGCAAACACTCGGTCGTACCATTAT CCTCACCTCAAGAAGGATGAAATTGAAAATATTGTAAAGGAGATGCTCGA AACAGGGGTGATTCGGCCAAGTTGCAGCCCCTATTCCTCACCGGTGCTAC TTGTACGTAAGAAGGACAGAACTTGGTGGATGTACATCGACTACCAAGCT TTAAATGACATCACCATCAAGGACAAGTACCTAATATCGTGGATGAACTT CTTGACGAGTTAAAAGGAGCTAGAGTCTTCACGAAGTTGGATCTCCGATC CGATTACCATCAAATTCGGGTATATGAAGACGACATTCCAAAATTGCATT CCGCACACATAACAACCATTATGAATTCTTGGTAATGCCTTTTGGAGTCA CTAATGCTCCTTCAACTTCCTAAAGTCTCATAAATGATATTTTTCGGAGC TTTCATCGCAAATTCGTGCTGGTATTTTTCGATGATATTCTCATTTATAA CCCTTCTTTTGAGACTCACTTTCGGCATTTACGGGTTGTTTTGACGATCC TTCAGGAGAATATTCTTTTCGTTAAGTAATCAAAGTGCAGCTTTCTCCAG CAAAAATTAGAGTACCTTGGGCACATAATATCAGAAGTAGCGGTAGACCC AACAAAAATCGAAGCAATGCAAGGCTGTCCGAAACCTACAAACGTGAAAT TACTGCACGGGTTCTTTGGAATAACGGGTTACTACCGAAAATTTATGAAG GACTATGAGAAGATCAGTGCACCCTTCACTTCTCCACTGAAAAAAGACTC CTTCCAATGGTCGGATAAAGCCTCTACTGCCTTAGACAAACTTAAGGTAG CCATGACGACGACGCCGGTGCTAGCGCTATCAAATTTCAGCCGACCCTTC ATCATTGAGGCCGATGCATCTGGAGTTGGGATTGGAGCCGTTCTCATGCA AGATGGTCGACCACTTGTATACACCAGCAAGGTGTTGTCTCCCTCCCATA AAAAATGTCAATATATGATAAGGAGATGCTCGCCTTTGTGCACGCAGTAA CGAGGTGGAGACCCTACCTGATCTGCCGGCGATTTTAAATTAAAACCGAC CATAGAAGCCTCAAGTACCTTTTGGAGCAGAAGATATCATCACCTGAGCA GCAAAAATGGGTAACCAAACTTCTAGGATTTAATTTGAAATCCTATTATG TAGATGCACTCAGCAAAAATGGGTAACCAAATCTCAAGTACCTATTATGA AATTATTTACAAAAAAGGGAATGAAAACGTTATTGTAGATGCACTCTCAC GGCTACTTGAGCAAACTGAATTTTCAGCCATCTCCCTTCCTACCACTAGC TTCTTCGAGGACATTAGGGAGGAATGGAAGAAGGATCGCCCACTATACTT AAGATTCGAGGGATCTACGTTACAAAGGTCGCATTGTGCTTGTACCCGAC TCCCCTTGCATCAAAATCATCCTGTACGAAATACACTCCACATCTTCAGT AGGGCACTTCGGATTTCTAAGAACCTACAAAAGAGTGAAGCAAAATTTTT ATTGGAAAGTGATGAAAAAAATTATTTTTGATTATGTGGCACAATGTGAT GTATGTCAACAACAAAAGGGTGAAACAGTGGTGAGTCCAAGGAAGCTACA ACCACTATCCATACTGGACTCGATGTGGACTGACATATCCATGGACTTTA TCAAAGGGTTGCCATCTTCCAAAGGTAAAAACACAATCCTCGTGGTGGTT GATTGACTTACGAAATATGCTCATTTTTGTGCTGTGCGAAATCCCTACAT TGCTGCTAGTATTGCTTAGATTTTCATAGAAAATATTGTTAAACTGCATG GGATGCCAAGGTCCATTATAAGTGATTGTGACAGGATCTTCACCAGTAAA TTTTGGATCGAGTTATTTCAGTTACAATGCACCAAACTCAAGATGAGCAC AACATATCATCCACAAATTGACGGCCAAACAGAGGTGGTGAACATGTGTT TAGAGACATACCTTCGGTGTTTCGCTAGTGACCGACCAAAGGAGTGGGCG AAATGGCTTCCTTGGGCCGAATGGTGGTATAATACTACATATTATTCATC TACAAAATGTGCCCCATATGAAGCACTGTATGGTTGGCCGACCCTTGTGA TTTCAAAGTATGTAATTAGCTCGGCCAAGGTAGATTAGGTCGACCAAGAT TTAATTGACAGGGACAAACTCCTACAGCTGCTAAAGGATAATCTCTCTAC CGCTCAAGCTAGAATGAAGCAGTAAGCCGACACACGATGAAGCGAAAGAG AGTTTTCAGTAGGAGATTGGGTCTATCTTTGCCTACAGCCATACAAGCAA CTCTCCATCAACACATGAGCCTCCATGAAGCTATCCCCATGTTTTTATGG GCCCTATCAAATCACAGAGCATACTGGAGTCGTGGCGTACAAACTTAAAT TGCTTGAGGATGCCAAAATTCACCTTTTCTTCCACGTGTCATGCTTGAAC ACGAGTTACCCCAGATCCAACTGCCAAACACCACTGATGATGGAGATATT TAAGCCTAACCACAAGTCATCCTCGACCGTAGAATCATGATGCGTCGTCG ACGTCCCTCTACTGAAGTACTAGTGCATTGGAATAATTTATTACTCGAAG ATGCCATATGAGAATCATATGAGGAGCTGAAGACCCGGTTCCCTGAGTTC ATGGAACCTCAGCTTTGAGGACAAGGTTGATTTTGAGAGGACGGGCTTGA TAGGACCTTAGTAGGGTTGGGTCCTACTCAACCAAGAAGCAGCTAATAAA AACCCTGTGAGATTGTAATAAACCCCACCTAGTCGTCTCTATCCTATAAA GGAGAGTAGCTAGGGTTTATATTTGCGCCTTTGGGCTTCCTAGCCATCGC CCCCCCTTTACTGGGCCGGTCGACTAGGGTTGAGGGCAAAAGGGGTAACT CACTTAGGAAACAACCCCTAGGGCTAGGGTTTGGAGCCCTATATAAGCAT GTAGCCTCATCTCTTTGGGAACAAGATCTATCTATAATTGCAGCCATTTG ACCGACTTCTAGGAGGGTGGAACCCCTATAGCGTTCCAAGGGTTGATCCC CCTCAAAGATCAATCTACATAAAATTCCTCTAGGGTTCTATCGGAGCATC TGCTAGACATTAATCAAATAAGATCAGTTATACATGTCAACCATTTGTGG ACAGTGGATATGACTTGCCAGAAGAGTACCTTCATGAACCCTGTTATTAC TTGCAATCACACAGTTTGGTAGTTCAGCTTAGCCATTTGTGTTTACAGTA AAATTTTATTTATGAAAAACTTATTCTCTACACTCTTGGTTTGGTTTATA CTTTTTGTTTATAATGGGTGTAGTGCAAGCCATCTTGTATAATGATGTCA ATGGCAAATAATATGTCAAAATCTTTTTCATTGAAAGATATATTGTCCTG TTATAGATTTAGGTTTTCTCTTCATTACTCCAATGCTTTACATTCTGTTA ATTGTAGCCCTTAAAGTCTGAATTACCTTTTTTGTTTCTTAATCATGTTG AGGGGTGCTGTTGTTCTCAAAAATGAGCAAAGTACGATCTGAAATGGCTT CAAATGATATGTGGAAGGTATATATGTTATAAAAAATAAATATTGAGTAC ATTTGCTTGGTTTATGTTTATTGAGTTCTTTGACTCCTTTATGGCTACAT GGTAATTTGTTTTTTTATATCTTTGAATAGTGAATTTAGATGACAGAATT GCTTCATCCTTTAGCATCAAATGTCAGACACATTCTGGGAGTCAAATTTC TCTAGCAAAAGTACTTAGATTTTAATTGGTTGGCCTTGCAAAGATATTGA ATGACAACATGATATATGTAGTTTTCTTTGCTTAGCTTGTATTACATCTC AAGAGATTACTTGATGATGGTTTCTCATTTGTTTCCTATGTGTTCGGTAT GCATGTCGGTGAGCCCACTTGTTGCTAGATTTGTCTTGGTATTAAGTTAA TTTTCATCTTTTCTAGATTCCAAAAAGGAAAATATAAAATGATAATTCCA ACAAAAATTGATTTGTCAAAACATATTTCACTGAGCTTCAATACTTTCAT AACATTGCCGTTTTGCAGTAAGTTTTTGTTTTGTGCTTAGATTGTACTAG TTGTTGCATTCTTTGTGAGCTGCTGAGAATTTCCCTGATTTGGTGCCATG TGCAGGTTGCAAGTTTGGCTGCTGTCTCTGTTACATGTTTCACATCATCT GCTGTGCTAGCTCTTGTTACTAATATTCCTGTATGTTGCTGCTTCTTGCT GACTTACAGTTTTTGTGCAACATCGAGTGAACTCAAGTTACATCTTAAGA TTTCCATGTTTCTTTGCAGCTGGAGGTGCTTTTTTATTGGCATGCAGCAC AATCAGACCACATAAGCAGTTCAGTTCTTATATTTCTGTATTATTTTATA GGTATGCCTGAATGTTTATGATTTACATACAAAATTAAATTAGTAGTTAA ACAAGCACATGTACTCCACGTGTCCTTTTTGTGACATACCATTCATATCT TTCAAGTAGACTAGTGTGCATGCATGATTTTGTCAAAAGGTTTGTGGAAG CTAGGCCGATTACCTTGTTGAACTCTAGCATCTTGCAAGTTCCATCTGCT TATCTGCTTTTGTCTAGTCATACTAATCCTGAAAAGCTCACCTTACACAA GTATTCTCAGGTTCATCAGTACCATCCGGATTTGTCTTGTGGGTTATGAG AGAAATGCCTCCTCGGCTTGTGGCTGATAGTCATAGACCAGCACGGCCTA CGGTCGTAAATTTTATCAGTGAAAGAACTACTCAAAATCCACAATGGAGG GCTACGGTAACATCCTCACAGAATAAGGTGCATTCAAAATCGTATGGGCC TTTTCTATTTATTATTTTTGTTTTTGCTTTTACTTTTGATCTGAATTTTT CACTAATTTGAGTTAGCTGTGACTATCTTTTGTTGTTTGCCGTGGGGATC ACCTACATTTTTCACCTCAATAAAGATGACGAAATCTAACTATGCTGAAA ACTCCTAAAATTGGGTAGCCTCACATGGTTAGATGTACAATTACTTGCCA TGCATCTAAGTATGACACACAAACTAGACTTGGTTGCAACTTTTAGCATG GCATCTAATGTTGATGGCAGTCAAAATAATTCATTTTCTTTTCATATTTG CGGTCAGCCACTGTTTTCCTTTTTCTTTCTTTTTTTTTTCTCCTTAACAC CCTATTTTTAGTTAATCTAGTGTATTCTGAAATCTGAAATACCAAAGTAA GGTTTCTTTCTTCTATTGAGCAAAATGTCAATTGCTCATATTTAACTTTG GAATACCTCAAAATCTTCGCACTTGCCATTGCAGGGTCTGAAATCAAGCC CAATATAAG
back to top

Coding sequence (CDS) from alignment at chrUn_random:33450..52408+

>Ma00_t00040.1 ID=Ma00_t00040.1|Name=Ma00_t00040.1|organism=Musa acuminata|type=CDS|length=1083bp|location=Sequence derived from alignment at chrUn_random:33450..52408+ (Musa acuminata)
ATGCGGACCGAGGGTGGGGCGGGGCACAGGTGCCTGCCGACCGAAGTCGT
GGCGGCAGATGCCGCCCTGGCGGTCGTCGACGGGGCCCTGGCGGTCGTCG
CTTTCTTGCAGTTGTTGAGAATTCACTTACGCAACCAACAACTTGGCTGG
ACTCGCCAAAAGATATTCCATCTCATGATTGGTTCATCCAACATCGGCTA
CTTGGTGTACTTTATTTTTACTATTGTTGCTACTTGTGAGGGATGGCAGT
GTTGGTCACATGGCTGTGGGTTTATCCTCATGGCTTGTCCTCAGATTCTG
TTTCTAGCTGCTTTCCTTCTGCTTGTGTCTTTCTGGATTGACCTATGCCA
TCAGGCAAACGATGATGAAGAAGATGATGATGAACATGGATATAATGAAG
CTTTATTGGAAAAGTCAAAGAGCAAACAAGGTTCACCACATGTTGATGGC
CATATGAAATGTTGCTTTCCTCGAACCATTCATATTGGAAGTCGACAAAA
GTTTGTAATCTTGGTGATTGTCCTGACATTTGTTTCGGTGATTTCTTTTT
CCATCCTGATATGGATTGGTAGAGGAAAAACTCCTATCGATTCTTCTCTT
GTGGCTTGGGTTTCTTTGGATATTTTTTCTGTAGCTATACTCCTACTAGG
TGGTGCTTTAGCATGCTATGGGGTGCTGTTGTTCTCAAAAATGAGCAAAG
TACGATCTGAAATGGCTTCAAATGATATGTGGAAGGTTGCAAGTTTGGCT
GCTGTCTCTGTTACATGTTTCACATCATCTGCTGTGCTAGCTCTTGTTAC
TAATATTCCTCTGGAGGTGCTTTTTTATTGGCATGCAGCACAATCAGACC
ACATAAGCAGTTCAGTTCTTATATTTCTGTATTATTTTATAGGTTCATCA
GTACCATCCGGATTTGTCTTGTGGGTTATGAGAGAAATGCCTCCTCGGCT
TGTGGCTGATAGTCATAGACCAGCACGGCCTACGGTCGTAAATTTTATCA
GTGAAAGAACTACTCAAAATCCACAATGGAGGGCTACGGTAACATCCTCA
CAGAATAAGGGTCTGAAATCAAGCCCAATATAA
back to top
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g00040Ma00_g00040Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p00040.1Ma00_p00040.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2006360auto2006360Musa acuminataCDS
CDS-auto2006361auto2006361Musa acuminataCDS
CDS-auto2006362auto2006362Musa acuminataCDS
CDS-auto2006363auto2006363Musa acuminataCDS
CDS-auto2006364auto2006364Musa acuminataCDS
CDS-auto2006365auto2006365Musa acuminataCDS
CDS-auto2006366auto2006366Musa acuminataCDS
CDS-auto2006367auto2006367Musa acuminataCDS
CDS-auto2006368auto2006368Musa acuminataCDS
CDS-auto2006369auto2006369Musa acuminataCDS
CDS-auto2006370auto2006370Musa acuminataCDS
CDS-auto2006371auto2006371Musa acuminataCDS
CDS-auto2006372auto2006372Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2006373auto2006373Musa acuminataexon
exon-auto2006374auto2006374Musa acuminataexon
exon-auto2006375auto2006375Musa acuminataexon
exon-auto2006376auto2006376Musa acuminataexon
exon-auto2006377auto2006377Musa acuminataexon
exon-auto2006378auto2006378Musa acuminataexon
exon-auto2006379auto2006379Musa acuminataexon
exon-auto2006380auto2006380Musa acuminataexon
exon-auto2006381auto2006381Musa acuminataexon
exon-auto2006382auto2006382Musa acuminataexon
exon-auto2006383auto2006383Musa acuminataexon
exon-auto2006384auto2006384Musa acuminataexon
exon-auto2006385auto2006385Musa acuminataexon