Overview
NameMa00_t00020.1
Unique NameMa00_t00020.1
TypemRNA
OrganismMusa acuminata (DH Pahang)
Sequence length1131
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:21772..26770 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NotePutative Probable fructokinase-2
OriginRefSeq:rna43950
Old locus tagGSMUA_AchrUn_randomG17920_001
Old locus taggene32597
Previous locationchrUn_random:84859911..84864909
Cross References
External references for this mRNA
DatabaseAccession
GeneID103974352
GenbankXM_009389158.1
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ma00_t00020.1 ID=Ma00_t00020.1|Name=Ma00_t00020.1|organism=Musa acuminata|type=mRNA|length=1131bp
ATGACGTCGTTAACTCCAGGCCCCCTCCTTTCTTCTTCCCCGCGGCAGCA
GCGCCGCAGCCAGTGGTGGAACGCCGAGCACCCTCACCCCACCACCGAAC
ATCCCAGCCCAGCCCGCCTCTCCTTTGCCGCCTTCTCCTCCTCTTCCCCC
GCCGGCGCCGCCGCCATCTCCGTCTCGGCGGCGAAGCCGGTGGTGGTCGT
GGGCTCCGCCAACGCCGACATCTACGTCGAGATCGACCGCCTCCCCCTTG
AGGGCGAGACAATCGCCGCCCGCGCCGGGCAGACGCTCGCGGGCGGCAAG
GGCGCCAACCAGGCCTGCTGCGGCGGCCGCCTTGACTACCCCACTTACTT
CGTCGGCCAGATCGGGGACGACGCCCATGGGCGCCTTATCGAGGATGCCC
TCCGTGGCGGCGGCGTCCGCCTCGACCGCCTCGCGCGGGTGTCCAGCGCG
CCCACCGGCCATGCCGTGGTGATGCTGCAGTCCGACGGGCAGAACGCCAT
CATCATCGTCGGCGGGGCCAACATGAGCTGCTGGCCCGAGGATCCCCGCG
ACGAGGACTTGGAGGTCGTCCGTAGTGCCGGAGTGCTGCTGCTGCAGCGC
GAGATCCCCGATCGGGTCAATATCCAGGTCGCTCAGGCTGCAAAAGGTGC
AGGAGTTCCTGTTATTCTAGATGCTGGAGGGAAGGAAGGTCCTGTTCCTG
ATGAACTCATAAAGCTTGTGGATATTTTCAGCCCAAATGAAACAGAGTTA
GCACGTTTGACAGGAATGCCAACAGAGACTTTTGAACAGATCAGCCATGC
TGCAAAAAGAATCCATGAGAAGGCCGTCAAGAAAGTCCTAGTGAAACTTG
GGGCAAAAGGTTCAGCTCTATTTATTGAAGGGGAAGATCCAATCGTACAA
CCCATCATACCTGCTTCAGAAGTTCTTGATACCACGGGAGCCGGTGATAC
CTTCACTGCTGCATTTGCTGTGGCTCTTGTTGAGTGCAAGCCCATGAAAG
AATGCTTGAAATTTGCCGCTGCCGCAGCTTCACTCTGTGTTCAAGTTAAG
GGGGCCATCCCAAGCATGCCTGACAGAGCTGCAGTTGTCGAGCTTCTACA
GTCTCTCCAAGCTGATGCTGCTACAAAGTGA
back to top

protein sequence of Ma00_p00020.1

>Ma00_p00020.1 ID=Ma00_p00020.1|Name=Ma00_p00020.1|organism=Musa acuminata|type=polypeptide|length=377bp
MTSLTPGPLLSSSPRQQRRSQWWNAEHPHPTTEHPSPARLSFAAFSSSSP
AGAAAISVSAAKPVVVVGSANADIYVEIDRLPLEGETIAARAGQTLAGGK
GANQACCGGRLDYPTYFVGQIGDDAHGRLIEDALRGGGVRLDRLARVSSA
PTGHAVVMLQSDGQNAIIIVGGANMSCWPEDPRDEDLEVVRSAGVLLLQR
EIPDRVNIQVAQAAKGAGVPVILDAGGKEGPVPDELIKLVDIFSPNETEL
ARLTGMPTETFEQISHAAKRIHEKAVKKVLVKLGAKGSALFIEGEDPIVQ
PIIPASEVLDTTGAGDTFTAAFAVALVECKPMKECLKFAAAAASLCVQVK
GAIPSMPDRAAVVELLQSLQADAATK*
back to top

mRNA from alignment at chrUn_random:21772..26770+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ma00_t00020.1 ID=Ma00_t00020.1|Name=Ma00_t00020.1|organism=Musa acuminata|type=mRNA|length=4999bp|location=Sequence derived from alignment at chrUn_random:21772..26770+ (Musa acuminata)
AGGTATATTGTAATAGACTTCCATCACCACTTCGCTCAACCAAGTTGTAC AACGGCGAAGACGAGCTCCCATGACGTCGTTAACTCCAGGCCCCCTCCTT TCTTCTTCCCCGCGGCAGCAGCGCCGCAGCCAGTGGTGGAACGCCGAGCA CCCTCACCCCACCACCGAACATCCCAGCCCAGCCCGCCTCTCCTTTGCCG CCTTCTCCTCCTCTTCCCCCGCCGGCGCCGCCGCCATCTCCGTCTCGGCG GCGAAGCCGGTGGTGGTCGTGGGCTCCGCCAACGCCGACATCTACGTCGA GATCGACCGCCTCCCCCTTGAGGGCGAGACAATCGCCGCCCGCGCCGGGC AGACGCTCGCGGGCGGCAAGGGCGCCAACCAGGCCTGCTGCGGCGGCCGC CTTGACTACCCCACTTACTTCGTCGGCCAGATCGGGGACGACGCCCATGG GCGCCTTATCGAGGATGCCCTCCGTGGCGGCGGCGTCCGCCTCGACCGCC TCGCGCGGGTGTCCAGCGCGCCCACCGGCCATGCCGTGGTGATGCTGCAG TCCGACGGGCAGAACGCCATCATCATCGTCGGCGGGGCCAACATGAGCTG CTGGCCCGAGGATCCCCGCGACGAGGACTTGGAGGTCGTCCGTAGTGCCG GAGTGCTGCTGCTGCAGCGCGAGATCCCCGATCGGGTCAATATCCAGGTC GCTCAGGTAATCGAAGATTTGCGGTTTTAAGATTACGTACCACTCATCAT TGGAGCTGCGTACCTTTTTTGAGATCTGGAATTGCTTGCATCTTGCATCA TGGCTGAATGCTTTTTTTTCCCCCTTCTGATCTGGATTTGCTTCGTTCTC CGGAATCCAAAATGTCATCTTTCCCCATTGTTACCATTTATGCGTCTTTA TTTCCTTATACAGAAATTGGCTCTTTCTTCGTTTTCTCTTGGTGCAAGTC TGTTCTTTCTTCTTCTTATTCTATTGCTGTGCTAAATTTGAAAATCTCTC GTTAAGCGGAAAAAGAGTCCAGACCTGTGCGCACAAGGTTGTCCAAGGTA CCTCCGAGATGGAAACATCAAGCTTTCGAGGTGTCACCTGCATGAAGACC AAGCTTTCGAGGTGTCACCTGCACGAAGACCAGGTCGAGAGAGGTTTTCT AATCCAATTCCTCCGACACCCAAGTTAGTGATCCAAGGTAGATGCGTGTG GACACGACGCAAGTGGTGAAAAATAACCCCTTACGATTGTGGTAAAATGA GATTTTATATTTGGTCGTAAATAGGTAAAATATTCTTTGGAATATTCTAC CTATTTACGAGGTGTCATCTGCACGAAGACCAAGGTCGAGAGAGATTTTC TGACCCAATTCCTCTGACACCCAAGTTAGTGATCCAAAGTAGATGCATGT GGACGTGAGTGGTAAAAAATAACCCCTTACGATTGTGGTAAAATGAGCTT TTATACTTGGTCGTAAATAGGTAGAATATTCTTTGGAATATCTTGTGGGA AGGCAATCCTCAACCACCTCTGACAACCTCACATTGGCCTTTTCTCCACG TGAGCGACAAGGGGGGAGACAGCCTACAATTGTTTATCTTGGATCTTTGT CCACGCGTGAAGACCAGTGAGGGGGCATCCTTTGTCTCTTTTTTCTAGTT TGGATGCCATGTGGAGGCCACGTGTCGGATGATGATTGGTCGAAGATATT CTCCCTATCATTTGTCCTCTTCCCCGAAGGTGCGCTTTAGGAATTTTTCC CAAGAGATCCCGAAGTGCAGCTATCAGCTTATCCGACACGTGCACCATAT AGAGTTGGGCGGGGGGGGGAAGCCATCGAGATGCCTATTTCGGGTCGCCA ATCTCACTTGGGATTTGGCAATCGAAGGAATTTGTAATCAGAACCAATTC CTCTAATCCTTGGTGTTTTCCAAGAGCAAGCATTCACCCGATGAAGAGAT CCACAGAGAGATTCAAGCTTTGCAACTTGTCGAGCCACCTAACTGTGAAT TGACTGCTCCACTGAGCTTATTGTAAGAGATATCCAATGTCTCTAAATCC AACATCTCTCTCTTCTCTCTTCCCTTCCGCTCAGCCATGGCAATCGTGAT TGTTCAAAGGATGGGGAGAAGCTGGAAGGCGTTGAAGAACTTGTTGCCGA GTAACATCAACATCTCCATCGGCGAATCCTCGTCTCCGCTTGGGGGAAGT GTGCAAGGAGAGCCGAGACGGGCTCTCCTTGCTCCTCTTGTCGAAGAACT CTAAGAAAGCCCCTTCTAAGCCCAAGTCTTCCACGGTGGCTAGCGAGTCC TTCATAGACGAGTTGCAAGAACTATAGGGGTGACTGCATCTGCTCTAGCT AGAGGGCAAGAAAATGGAGGAGCGAGGGGGATCGGGGCCCTCGACCTCCA TGCCTTGGTATCGAGGAGGGGTCAGAGCACCCGACCTCCACACATCTGTG GCAAGGGGCTCATGGCGCTCGACCTTCAAGCCTTATCAACGAAGGGGGTG GGGCACCCGACCTCTACAACTTGCACGAAGACTAACGAGGTCGAGAGAGG TTTCCCGACTCGATTCCTTCGACACCCAAGTTAGTAACCCGAGGTAGGTG CATGTTGATGCGAGTGGTGAAAAATGACCCCTTGCAACTATGCTAAAATG TGCCTTTATACCTAGTCGTAAATGGGTGAATATTTTGTGGAATATTCTAC AAGGAGGCAATCCTCAATCGCCACTAACAATCTCCCATTGGCCTTTTCTC CATGTGGGCGACAAGGGGGGAGACAACTTGCAATTACTTGTCTTGGACCC TTGTCCACGTGGGCAGATCAGTGGGGCCAACTTGTCTCCTTCTTCCAGCC TGGATGTCACACGGAGGCCACGTGTCGGATGACGATTGGTCGACGTTAAT CTCTCTATCACTGATAATATTAATCTATCTCTCACTTTTGGATGAAGATA GAATACTTCTACTATTTCTCTAGGATGTTATAAATGCTGTTGGATGTGAA AAAAATTGATTTTTATCTTTGTTTGTGTTGTTAATAGAAATAAAACTTGG AAATTTATGCCCTAGAGTAACTTTAGTTTATCATATTATTATCTCTAAGT TCAGAAACAGGATTCTCTTCTTTAATACTTTTTTTCTTGATTGATGTTGA GCATTGATGTTAAGATGGATGAAAACTGTGTGGTTCTGTTTTACTTTGAT CCTGCACCATTGAATTTCAAATTACCAAGTCTTTTTTCTTGACTTCAAGC GGTCTGATCTGGTTTGTTGACTTGTTCTTGAGCTCACATGCTTGAAAGTG TTTCTTAGGGCTTGATATCTAATACTATGTTGATGTACGTTTTTGCTTCA TGTGTGCTGATTGCTTGCGTGGATAATTATCGGCTACAACACATGTTTTG TGTTGTTTCCTGCCTTCCTTTATAATGCCTGTCCATGTTTTGGCATTAAG TTGAATCCTTGTCATCTTCAGGCTGCAAAAGGTGCAGGAGTTCCTGTTAT TCTAGATGCTGGAGGGAAGGAAGGTCCTGTTCCTGATGAACTCATAAAGC TTGTGGATATTTTCAGCCCAAATGAAACAGAGTTAGCACGTTTGACAGGA ATGCCAACAGAGACTTTTGAACAGATCAGCCATGCTGCAAAAAGAATCCA TGAGAAGGTGAGATCAATGTCTTAGCAATAACTTCATTCACCCCTTTTTT GCTTTTTGTTGCTTCTCGAAGAAACACTTAAAAGTGTCCTGAAACTTGGA ATTGTCCCTTTATCAATGAATCGAGAGTATATTACTTTGCTTTGTTTTTT AATTTTTTAATGATAGCATATTTTAAAATGCATTATATCCTATCTTTTCT TTTTCCTTTTCGTCATAGGAAGTTATATGAGATGGACAAATGTTGAATAC TATGTATAGGTATTAGATCATGGGACTTATATTTTTCAAAATATGGGTCC AAGATGAACTATTAAACCAACGAGTCTGACTTCTTTTTAGGATGATGCTT ACCATGATGTTTTCAGAAAAATCTTATTTTAAAAGTTGATGCTTTTATAA AACACAATTGATGTAACAAACACAAGACCTTTCTGAAAGGTCCTGTGATG GTTGTTCTTTTAATTCCTGCATTTGTTGTATTTTGAGGTTCACTGATAAT GTGAATACTCAGGACTGTACCTTCTGATATTTGATACAGATCAATGCAGG TCCTAAAATCAAATTCAAGGACTGTTAGTTTAGTATAGATCTAATCTTGT CGATAATTGTTCCTGCAATCTTTAGTATTCCAAAACATGCAATCTCCACA TATCAAGTTGATTTGGCATCTAGCTGCCATCAAGAGCATATCAGCAATAC TATGTTACTTAACAAACAGCATATAGGCAATTGAAGAATGATTTTATTAG AGAGATGCCCAGACATTAAATCTCATGAAGCATTAGATGGTAATGCTGCC ACTTTTTTGTATCAGGCCGTCAAGAAAGTCCTAGTGAAACTTGGGGCAAA AGGTTCAGCTCTATTTATTGAAGGGGAAGATCCAATCGTACAACCCATCA TACCTGCTTCAGAAGTTCTTGATACCACGGGAGCCGGTGATACCTTCACT GCTGCATTTGCTGTGGCTCTTGTTGAGTGCAAGCCCATGAAAGAATGCTT GAAATTTGCCGGTACAGAGAAACAAAACTCCTATTGCATGGTTCTCATGT CATCCTAGGTAACTAATAAAACTCCTTGATCGTTATGCTGCAGCTGCCGC AGCTTCACTCTGTGTTCAAGTTAAGGGGGCCATCCCAAGCATGCCTGACA GAGCTGCAGTTGTCGAGCTTCTACAGTCTCTCCAAGCTGATGCTGCTACA AAGTGAACAACTAAGCCAACATAATTCTCAAACTTTCGGAATAAACGTTG TCATGCCTTTTCTTCTTTTTGTTCCACCAAGTGTAATTACTTATCAGTGT TTAAAGTACAGGTATTGAATCAGTAATCTCTTTGGTGGGCATTTCCAGT
back to top

Coding sequence (CDS) from alignment at chrUn_random:21772..26770+

>Ma00_t00020.1 ID=Ma00_t00020.1|Name=Ma00_t00020.1|organism=Musa acuminata|type=CDS|length=1131bp|location=Sequence derived from alignment at chrUn_random:21772..26770+ (Musa acuminata)
ATGACGTCGTTAACTCCAGGCCCCCTCCTTTCTTCTTCCCCGCGGCAGCA
GCGCCGCAGCCAGTGGTGGAACGCCGAGCACCCTCACCCCACCACCGAAC
ATCCCAGCCCAGCCCGCCTCTCCTTTGCCGCCTTCTCCTCCTCTTCCCCC
GCCGGCGCCGCCGCCATCTCCGTCTCGGCGGCGAAGCCGGTGGTGGTCGT
GGGCTCCGCCAACGCCGACATCTACGTCGAGATCGACCGCCTCCCCCTTG
AGGGCGAGACAATCGCCGCCCGCGCCGGGCAGACGCTCGCGGGCGGCAAG
GGCGCCAACCAGGCCTGCTGCGGCGGCCGCCTTGACTACCCCACTTACTT
CGTCGGCCAGATCGGGGACGACGCCCATGGGCGCCTTATCGAGGATGCCC
TCCGTGGCGGCGGCGTCCGCCTCGACCGCCTCGCGCGGGTGTCCAGCGCG
CCCACCGGCCATGCCGTGGTGATGCTGCAGTCCGACGGGCAGAACGCCAT
CATCATCGTCGGCGGGGCCAACATGAGCTGCTGGCCCGAGGATCCCCGCG
ACGAGGACTTGGAGGTCGTCCGTAGTGCCGGAGTGCTGCTGCTGCAGCGC
GAGATCCCCGATCGGGTCAATATCCAGGTCGCTCAGGCTGCAAAAGGTGC
AGGAGTTCCTGTTATTCTAGATGCTGGAGGGAAGGAAGGTCCTGTTCCTG
ATGAACTCATAAAGCTTGTGGATATTTTCAGCCCAAATGAAACAGAGTTA
GCACGTTTGACAGGAATGCCAACAGAGACTTTTGAACAGATCAGCCATGC
TGCAAAAAGAATCCATGAGAAGGCCGTCAAGAAAGTCCTAGTGAAACTTG
GGGCAAAAGGTTCAGCTCTATTTATTGAAGGGGAAGATCCAATCGTACAA
CCCATCATACCTGCTTCAGAAGTTCTTGATACCACGGGAGCCGGTGATAC
CTTCACTGCTGCATTTGCTGTGGCTCTTGTTGAGTGCAAGCCCATGAAAG
AATGCTTGAAATTTGCCGCTGCCGCAGCTTCACTCTGTGTTCAAGTTAAG
GGGGCCATCCCAAGCATGCCTGACAGAGCTGCAGTTGTCGAGCTTCTACA
GTCTCTCCAAGCTGATGCTGCTACAAAGTGA
back to top
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Ma00_g00020Ma00_g00020Musa acuminatagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ma00_p00020.1Ma00_p00020.1Musa acuminatapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS-auto2006340auto2006340Musa acuminataCDS
CDS-auto2006341auto2006341Musa acuminataCDS
CDS-auto2006342auto2006342Musa acuminataCDS
CDS-auto2006343auto2006343Musa acuminataCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon-auto2006344auto2006344Musa acuminataexon
exon-auto2006345auto2006345Musa acuminataexon
exon-auto2006346auto2006346Musa acuminataexon
exon-auto2006347auto2006347Musa acuminataexon