Overview
NameMa00_p05190.1
Unique NameMa00_p05190.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length188
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:45046341..45046907 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g05190~ 60S ribosome subunit biogenesis protein NIP7, putative, expressed~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103996769
GenbankXM_009417759.1
InterProIPR002478
InterProIPR005155
InterProIPR015947
InterProIPR016686
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p05190.1 ID=Ma00_p05190.1|Name=Ma00_p05190.1|organism=Musa acuminata|type=polypeptide|length=189bp
MRPLDEKETAAVFEKLFKFTGPNLKVMVERPAVEGPAGDDPGRYCLRLHK
NRVYYASESLVRRATNVARDRLVSLGTCLGKFTKGGSFRLTVQSLDLLAA
HARRKVWLKPTAEMSFLYGNPVLKSGLARITEGVSPGDGVVVFSMSDLPL
GFGVAARSTQDCRKAHADAIVVNRQADAGEYLRNEDDL*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t05190.1Ma00_t05190.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
60S ribosome subunit biogenesis protein NIP7, putative, expressed60S ribosome subunit biogenesis protein NIP7, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003723RNA binding
Vocabulary: Biological Process
TermDefinition
GO:0042255ribosome assembly
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus