Overview
NameMa00_p04420.2
Unique NameMa00_p04420.2
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length663
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:37731234..37739657 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g04420~ lipase class 3 family protein, putative, expressed~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974810
GenbankXM_009389700.1
InterProIPR029058
InterProIPR005592
InterProIPR002921
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04420.2 ID=Ma00_p04420.2|Name=Ma00_p04420.2|organism=Musa acuminata|type=polypeptide|length=664bp
MATATMATAAGAAALLYYTLKWKLHAGRFQENGQGEHDQDASKPILSGRN
RVSQRPAQAPATWLETISTLSETLRFTYSETLGKWPIGDLAFGINFLLKR
QGNLHVASIYAGEESVPLKGAEIVAELKYLLNLLNLCWHFSKKPFPLFLE
ATGYSQDDVLLQKPKAGILKPAFTILTDKSTKSILLLIRGTHSIRDTLTA
ATGAVVPFHHTLLYEGGISDLILGYAHCGMVAAARSIAKLATPCLLEALH
EYPDYKLKIVGHSLGGGTAALLTYILREQQEFATAICVTFAPAACMTWEL
AESGRHFITSIINGADLVPSFSAASVDDLRSEVTASAWLNDLRNQIEQTR
ILSTVYRSASALGSRLPSIASARARVAGAGAILRPVSNGTQVVMTRAKSV
AQAALSRPPLRISSWSCIGPRYRNKASFPITRREENIEESSMITKENGET
IATLTETTTVETTEITTQGVGWTSDLDCSHSSAISHADGPVNTGDISDDE
DATGQCRNEDSMTEYDLWQQLENELNKARQNEEVDIDNEIREEENAAAAA
HEEVEGTSEGILTETKEVRRFYPPGKIMHIVIFPPEETTNEEDSGIHHDG
ENPEPEYKTGIFLTPRSLYGKLRLSQSMINDHFMPIYRRNIERLISILEK
DNFEDGHGDEAML*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04420.2Ma00_t04420.2Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
lipase class 3 family protein, putative, expressedlipase class 3 family protein, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0016042lipid catabolic process
GO:0006629lipid metabolic process