Overview
NameMa00_p04350.1
Unique NameMa00_p04350.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length194
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:36571664..36572248 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g04350~ Cytochrome P450 78A1~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974707
GenbankXM_009389581.1
InterProIPR001128
InterProIPR002401
InterProIPR017972
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04350.1 ID=Ma00_p04350.1|Name=Ma00_p04350.1|organism=Musa acuminata|type=polypeptide|length=195bp
MAELVLHPEVQAKLRREIDAVIGRDHVPTDADVVRMPYLQAVIKETFRNH
PPGPLLSWARLSTDDVHLSNGMLVPAGTTAMVNMWAIAHDAKVWARPDCF
EPERFVDADGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVGLWVARL
AHGFEWAPVDGAAVDLGEVLKLSLEMKTPLTAAATPRENVVGVL*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04350.1Ma00_t04350.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Cytochrome P450 78A1Cytochrome P450 78A1
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005506iron ion binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process