Overview
NameMa00_p04300.1
Unique NameMa00_p04300.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length136
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:36087878..36088288 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT17300_001
Old locus tagGSMUA_AchrUn_randomG17300_001
NoteMa00_g04300~ retrotransposon protein, putative, unclassified~ unknown_gene~ fragment
Color6
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9IK83
TrEMBLQ8BEL9
TrEMBLC4NFN0
TrEMBLC4NFM5
TrEMBLB5AK50
TrEMBLA7LLW7
TrEMBLA7J1K4
TrEMBLA6MV67
TIGROs12g42720.1
TIGROs12g08880.1
TIGROs09g26640.1
TIGROs08g43030.1
TIGROs07g12000.1
TIGROs07g05790.1
TIGROs05g31340.1
TIGROs04g34110.1
SwissProtQ02964
SwissProtQ00962
SwissProtP27502
SwissProtP19199
SwissProtP05400
SwissProtP03556
SwissProtP03555
SwissProtP03554
InterProIPR002156
GreenPhylGP000198
InterProIPR012337
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04300.1 ID=Ma00_p04300.1|Name=Ma00_p04300.1|organism=Musa acuminata|type=polypeptide|length=137bp
MEGWGGGGGVCKWKNKKGDPRNSERVCAYASGKFSPIKSTIDAEIHAVMK
TLEALKIYYIDKREILIRTDCQAIISFFNKSTQNKPSRVRGMTFVDYITG
NGIEVQFEHIEGTSNILADSLSRLINVLINAGWKDE*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04300.1Ma00_t04300.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
retrotransposon protein, putative, unclassifiedretrotransposon protein, putative, unclassified
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0004523RNA-DNA hybrid ribonuclease activity
GO:0003676nucleic acid binding