Overview
NameMa00_p04290.1
Unique NameMa00_p04290.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length97
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:36084677..36085208 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT17290_001
Color6
Old locus tagGSMUA_AchrUn_randomG17290_001
NoteMa00_g04290~ Protein Ycf2~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ33615
TrEMBLD4PBF5
TrEMBLD3JJD2
TrEMBLC3UP16
TrEMBLA9QBH8
TrEMBLA9QB86
TrEMBLA9QAQ5
TrEMBLA9QAN9
TIGROs12g35490.1
TIGROs11g37780.1
TIGROs01g25600.2
TIGROs01g25600.1
SwissProtQ6EVY7
SwissProtQ3V4Z0
SwissProtP61241
SwissProtA9LYE4
SwissProtA6MMY8
SwissProtA6MMQ1
SwissProtA1XGT0
SwissProtA1XFZ9
InterProIPR008543
GreenPhylGP001020
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04290.1 ID=Ma00_p04290.1|Name=Ma00_p04290.1|organism=Musa acuminata|type=polypeptide|length=98bp
MEAVNQYRLNQNPIQIQFSTYGQKKCKNFQEHLEHFISKQKSCFQVVLNR
LLINQYLIDWSKAINKQHLSKSLRFFLSKSLPFLFKTLPLFFMSIGC*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04290.1Ma00_t04290.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Protein Ycf2Protein Ycf2
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Cellular Component
TermDefinition
GO:0009507chloroplast
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding