Overview
NameMa00_p04190.1
Unique NameMa00_p04190.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length124
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:35575241..35575715 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT29080_001
Old locus tagGSMUA_AchrUn_randomG29080_001
Color6
NoteMa00_g04190~ Protein ROOT INITIATION DEFECTIVE 3~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9M3B4
TrEMBLQ8LBC4
TrEMBLQ7XAL8
TrEMBLQ2HSF1
TrEMBLQ0D724
TrEMBLE0CPU3
TrEMBLD7LSF3
TrEMBLB9MVS5
TIGROs07g22534.4
TIGROs07g22534.3
TIGROs07g22534.2
TIGROs07g22534.1
TIGROs05g23580.1
TIGROs04g55410.1
TIGROs04g29650.1
TIGROs03g49200.2
SwissProtQ9BV38
SwissProtQ6C953
SwissProtQ4VBE8
SwissProtQ4V7Y7
SwissProtQ499N3
SwissProtQ3SZD4
SwissProtQ2KJJ5
SwissProtQ12448
GreenPhylGP001178
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04190.1 ID=Ma00_p04190.1|Name=Ma00_p04190.1|organism=Musa acuminata|type=polypeptide|length=125bp
MEVVISSSPVDVGIGCWDLRSGFEQLRYRSCSSAPHGLLSIAGRFLASSQ
LRDSPSSASCPIFFWSWDKPQVEVRSFPVEPIGPLVSNSEGTYVMGGGPS
GIIYQWEVIFCFSTSDFLGKICFFC
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04190.1Ma00_t04190.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Protein ROOT INITIATION DEFECTIVE 3Protein ROOT INITIATION DEFECTIVE 3
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene