Overview
NameMa00_p04160.1
Unique NameMa00_p04160.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length63
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:35544742..35547096 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr8T34540_001
Old locus tagGSMUA_Achr8G34540_001
NoteMa00_g04160~ Uncharacterized protein~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9LZA0
TrEMBLQ6NQJ6
TrEMBLD7THN0
TrEMBLD7M7A0
TrEMBLC5XPP8
TrEMBLB9HBM5
TrEMBLB9EUD2
TrEMBLA5AY17
TIGROs12g04595.1
TIGROs01g62440.3
TIGROs01g62440.2
TIGROs01g62440.1
SwissProtQ725S3
SwissProtP73177
SwissProtA1V9F1
GreenPhylGP000883
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04160.1Ma00_t04160.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04160.1 ID=Ma00_p04160.1|Name=Ma00_p04160.1|organism=Musa acuminata|type=polypeptide|length=64bp
MSCKWDYQAVRSYLMLNWRRKLAGLLLEFRKDSQKTLPPVVQKLDGKKNW
MVCDPVPINNFCC*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene