Overview
NameMa00_p04070.1
Unique NameMa00_p04070.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length59
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:34241356..34241535 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT18770_001
Old locus tagGSMUA_AchrUn_randomG18770_001
Color6
NoteMa00_g04070~ Putative expressed protein~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ6YU39
TrEMBLD7TCF3
TrEMBLC5X3I9
TrEMBLB9MUR5
TrEMBLB9FWL6
TrEMBLB8B509
TrEMBLB4FK39
TrEMBLA5BGQ4
TIGROs10g41160.1
TIGROs10g10334.1
TIGROs10g10320.1
TIGROs07g17300.1
TIGROs06g31840.1
TIGROs04g30460.1
GreenPhylGP000447
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04070.1Ma00_t04070.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04070.1 ID=Ma00_p04070.1|Name=Ma00_p04070.1|organism=Musa acuminata|type=polypeptide|length=60bp
MVSVQEPVDGKPPLYGHVTFYSLATLLRVLNGNVKVKFMTQGKHLWVRRF
IPKKKKNQG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative expressed proteinPutative expressed protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene