Overview
NameMa00_p04040.1
Unique NameMa00_p04040.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length39
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:33679916..33680125 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT19850_001
Old locus tagGSMUA_AchrUn_randomG19850_001
Color6
NoteMa00_g04040~ DAG protein, chloroplastic~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ2R8U1
TrEMBLO49429
TrEMBLD7TGZ7
TrEMBLC5Y1R1
TrEMBLB6SJX7
TrEMBLB4FZC0
TrEMBLB4FQE6
TrEMBLA2ZCN8
TIGROs11g11020.1
TIGROs09g33480.1
TIGROs08g04450.3
TIGROs08g04450.2
TIGROs08g04450.1
TIGROs06g02600.1
TIGROs04g51280.1
TIGROs03g38490.1
SwissProtQ38732
GreenPhylGP000534
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04040.1 ID=Ma00_p04040.1|Name=Ma00_p04040.1|organism=Musa acuminata|type=polypeptide|length=40bp
MYAFSTTTYHGFQAVLTKEMSQKFRGLHGVVFILPDLLG*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04040.1Ma00_t04040.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
DAG protein, chloroplasticDAG protein, chloroplastic
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene