Overview
NameMa00_p04020.1
Unique NameMa00_p04020.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length81
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:33530303..33530713 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT19600_001
Old locus tagGSMUA_AchrUn_randomG19600_001
Color6
NoteMa00_g04020~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ94S36
TrEMBLQ5U6F8
TrEMBLQ5MFF4
TrEMBLD7RMU8
TrEMBLB9U3M6
TrEMBLB6VJV3
TrEMBLB2CW50
TrEMBLA5AWC5
TIGROs12g14930.1
TIGROs08g19170.1
TIGROs06g38340.1
TIGROs02g14929.1
SwissProtQ04613
SwissProtQ00058
SwissProtP68538
SwissProtP68537
SwissProtP21407
SwissProtP09004
SwissProtP09003
SwissProtB8GQ66
InterProIPR000467
GreenPhylGP000656
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t04020.1Ma00_t04020.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p04020.1 ID=Ma00_p04020.1|Name=Ma00_p04020.1|organism=Musa acuminata|type=polypeptide|length=82bp
MARCAPKCQKTVQALFFRNLNVPAATLPNATSSRLQDDLVTGWNFWLSEK
FLPGSGLGRRNQGIVEPIHVQAIEPFGYIPK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding