Overview
NameMa00_p03990.1
Unique NameMa00_p03990.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length133
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:33377010..33379350 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T27620_001
Old locus tagGSMUA_Achr1G27620_001
Color6
NoteMa00_g03990~ Protein FREE1~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9ASS2
TrEMBLQ43611
TrEMBLE0CQA1
TrEMBLD7KI97
TrEMBLB9R8C9
TrEMBLB9H510
TrEMBLB9GQR8
TrEMBLB7FNH2
TIGROs08g34950.1
TIGROs07g42500.1
TIGROs07g38580.1
TIGROs07g17130.1
TIGROs06g50840.1
TIGROs03g46710.1
TIGROs02g13890.2
TIGROs02g13890.1
SwissProtQ9TZD0
SwissProtQ8IZQ1
SwissProtQ6VNB8
SwissProtQ54CH1
SwissProtQ4P7Q1
SwissProtB4M140
SwissProtB4K982
SwissProtA8XJZ8
InterProIPR017455
InterProIPR011011
InterProIPR000306
GreenPhylGP000738
InterProIPR013083
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03990.1Ma00_t03990.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03990.1 ID=Ma00_p03990.1|Name=Ma00_p03990.1|organism=Musa acuminata|type=polypeptide|length=134bp
MGGNGSLTRGEEAADASKVSDQSAERTKSLVDWMNLIKPANGEKDHWVLD
EAVSKCTSCGSDFGAFNRRHHCRNCGDNLCDKCTKGRIALTAEENAQQVR
VCDRCMAEVSQRLSNAKEAVSKPAGLQSHEDLV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Protein FREE1Protein FREE1
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0046872metal ion binding