Overview
NameMa00_p03980.1
Unique NameMa00_p03980.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length71
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:33376405..33376938 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T27610_001
Old locus tagGSMUA_Achr1G27610_001
Color6
NoteMa00_g03980~ zinc finger family protein, putative, expressed~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9ASS2
TrEMBLE0CQA1
TrEMBLC5Z1Y1
TrEMBLC0PT57
TrEMBLB7FNH2
TrEMBLB4FTB0
TrEMBLA9NUZ3
TrEMBLA6N121
TIGROs08g24390.4
TIGROs08g24390.2
TIGROs08g24390.1
TIGROs07g38580.1
TIGROs06g50840.1
GreenPhylGP000738
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03980.1Ma00_t03980.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03980.1 ID=Ma00_p03980.1|Name=Ma00_p03980.1|organism=Musa acuminata|type=polypeptide|length=72bp
MEGIFFSLLENDLEELNKNHKLGSNSDESWKPMREVACPICTVHLQVQVP
ASGSQTIECGVCQHPFLVSAD*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
zinc finger family protein, putative, expressedzinc finger family protein, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene