Overview
NameMa00_p03950.1
Unique NameMa00_p03950.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length258
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:33048165..33049534 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g03950~ Alpha-humulene synthase~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974196
GenbankXM_009388957.1
InterProIPR001906
InterProIPR008949
InterProIPR008930
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03950.1Ma00_t03950.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03950.1 ID=Ma00_p03950.1|Name=Ma00_p03950.1|organism=Musa acuminata|type=polypeptide|length=259bp
MSSQCLVASVVEEVARKTSGYHPSVWGDYFITHVSPSSEAQDNHEWMEER
SRELREQIKSMLQDYSDLLQTMQLIDAIQLLGVAYHFEKEISDALSKVYD
ADFNTHGLYEASLRFRLLRQHGYNISPYVFNKFKDEEGSFMSDLKGDVEG
LLSLYNAAYLGTHGETILDEVISFTRSILTSMLSDLEPPLLSKVSLSLET
PLFRRTKRLLTRNYISIYQEDATRNDVLLELAKLDFNLVQSLHREELKSL
SMLVFSLF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Alpha-humulene synthaseAlpha-humulene synthase
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0010333terpene synthase activity
GO:0016829lyase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process