Overview
NameMa00_p03900.2
Unique NameMa00_p03900.2
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length383
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:32425596..32430232 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g03900~ Putative Acyl-CoA-binding domain-containing protein 3~ unknown_gene~ modules
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103973555
GenbankXM_009388163.1
InterProIPR000582
InterProIPR014352
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03900.2Ma00_t03900.2Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03900.2 ID=Ma00_p03900.2|Name=Ma00_p03900.2|organism=Musa acuminata|type=polypeptide|length=384bp
MGTMEFFEELLLTALISVLLAFLIGKFAASAAVKPEAVPLARVAGPGMDS
DPIEEEEETEKSERKSSSGNGAGSDRPKTGVFEVVEERLLEERPERSDEV
SGFDLNRENIADKLFSEVDLTRSEESSSKKEKVDNEVEIGRINDDSRRQQ
GGSVKGKEDGKKAVEKVVKLGREDAVDKEDGGEVGSLLHGEDEWEGIERS
ELEMLFGVASEFVGSKKGGDAVSKLSNEVQMQMYGLHKVATEGPCHEPQP
MALKVSSRAKWNAWQKLGNMDPEAAMGQYISLLNESIPGWTAKKYGEEAK
GHVGSDPRVVEASRIDQLDSKFSQSNSEIEVLVEDSSAIEGVADDVNTGV
KLSKQVFNWISVDVTGLTKIFLFNLVSPPRVAF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
modulesmodules
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative Acyl-CoA-binding domain-containing protein 3Putative Acyl-CoA-binding domain-containing protein 3
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0000062fatty-acyl-CoA binding