Overview
NameMa00_p03820.1
Unique NameMa00_p03820.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length135
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:31342737..31343144 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr7T16800_001
Old locus tagGSMUA_Achr7G16800_001
Color6
NoteMa00_g03820~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9FKJ5
TrEMBLQ940M3
TrEMBLD7SKX0
TrEMBLB9SWC6
TrEMBLB9SWC5
TrEMBLB9HQA6
TrEMBLB9HQA5
TrEMBLA5C5A2
TIGROs06g01320.1
TIGROs03g40560.1
TIGROs03g06139.1
TIGROs02g05310.4
TIGROs02g05310.3
TIGROs02g05310.2
TIGROs02g05310.1
TIGROs01g73720.1
SwissProtQ863C4
SwissProtQ21Y68
SwissProtP38586
GreenPhylGP001082
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03820.1Ma00_t03820.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03820.1 ID=Ma00_p03820.1|Name=Ma00_p03820.1|organism=Musa acuminata|type=polypeptide|length=136bp
MLQIGCPTAVAMGQCATILGSWGETARCSTSMEPRERTSLWCPTTSSRST
CTSSARGRRGGPATLPGCKPWPSCSSPTPWSSARWDGKKVTVPTEGEAEW
RVRAGGEGDGREVVVERTGETNSVRVTLGGWWRRT*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene