Overview
NameMa00_p03780.1
Unique NameMa00_p03780.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length146
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:31199340..31200603 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT22100_001
Old locus tagGSMUA_AchrUn_randomG22100_001
Color6
NoteMa00_g03780~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ7XS46
TrEMBLQ5Z845
TrEMBLQ01KD8
TrEMBLD7SU32
TrEMBLC7J0T4
TrEMBLB9FCD4
TrEMBLB8B247
TrEMBLB8ATV0
TIGROs08g12890.1
TIGROs07g06490.1
TIGROs06g48700.1
TIGROs06g45110.1
TIGROs04g51794.2
TIGROs02g22160.1
TIGROs02g07880.2
TIGROs02g07880.1
SwissProtQ4WJS4
SwissProtQ08DZ2
SwissProtP50812
SwissProtP22424
SwissProtC1F8M1
SwissProtA1D4C8
InterProIPR003406
GreenPhylGP000244
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03780.1Ma00_t03780.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03780.1 ID=Ma00_p03780.1|Name=Ma00_p03780.1|organism=Musa acuminata|type=polypeptide|length=147bp
MGQGTPGGMGNWGHPVIGSTMVTRRTKSLSRRRRRPESDGSYADRRVLRL
LPGSPPSPRSLSVVSTSSRSSASKTTSSWRSSPPTRSASIPRRRRTRRIP
GFDSRNCYADEHYLPTLLSMVDPIGSANWSVMHVDWSEGKWHPKAY*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity