Overview
NameMa00_p03770.1
Unique NameMa00_p03770.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length41
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:31196598..31196826 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT21880_001
Old locus tagGSMUA_AchrUn_randomG21880_001
Color6
NoteMa00_g03770~ DNA binding protein, putative, expressed~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ5Z845
TrEMBLD7SU32
TrEMBLD7MB74
TrEMBLC4J660
TrEMBLC0P7H1
TrEMBLB8B247
TrEMBLB7EKK3
TrEMBLB6T844
TIGROs08g12890.1
TIGROs07g06490.1
TIGROs06g48700.1
TIGROs06g45110.1
TIGROs04g51794.2
TIGROs02g22160.1
TIGROs02g07880.2
TIGROs02g07880.1
InterProIPR003406
GreenPhylGP000244
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03770.1Ma00_t03770.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03770.1 ID=Ma00_p03770.1|Name=Ma00_p03770.1|organism=Musa acuminata|type=polypeptide|length=42bp
PSFDSHNCYVDEYYLPTLLNMVDHTGIANWSVTHVDWSEGK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
DNA binding protein, putative, expressedDNA binding protein, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity