Overview
NameMa00_p03740.1
Unique NameMa00_p03740.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length338
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:30901356..30905110 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g03740~ Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974405
GenbankXM_009389227.1
EC1.2.1.12
InterProIPR006424
InterProIPR020831
InterProIPR020828
InterProIPR020829
InterProIPR016040
InterProIPR020830
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03740.1Ma00_t03740.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03740.1 ID=Ma00_p03740.1|Name=Ma00_p03740.1|organism=Musa acuminata|type=polypeptide|length=339bp
MAGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKY
DTVHGSWKHHEIKVKDSKTLLFGTKEVAVFGFRNPEEIPWGETGAEYVVE
STGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPDINIV
SNVSCTTNCLAPLAKVVHDKFGIIEGLMTTVHSITATQKTVDGPSSKDWR
GGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTV
RLEKPATYEEIKAAIKAESEGKLKGILGYVEEDLVSTDFLGDNRSSIFDA
KAGIALNGNFVKLVSWYDNEWGYSSRVVDLVRHMHKTR*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolicGlyceraldehyde-3-phosphate dehydrogenase 2, cytosolic
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661NADP binding
GO:0051287NAD binding
Vocabulary: Biological Process
TermDefinition
GO:0006006glucose metabolic process
GO:0055114oxidation-reduction process