Overview
NameMa00_p03710.1
Unique NameMa00_p03710.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length109
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:30824924..30825894 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT13250_001
Old locus tagGSMUA_AchrUn_randomG13250_001
Color6
NoteMa00_g03710~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ2V3H9
TrEMBLD7SSK4
TrEMBLD7M9W3
TrEMBLB9SA62
TrEMBLB9IH18
TrEMBLB9HCD2
TrEMBLA5C6C8
TrEMBLA5AP67
TIGROs11g37390.1
TIGROs07g48790.1
TIGROs05g41220.2
TIGROs05g41220.1
TIGROs04g54020.1
TIGROs03g63940.1
TIGROs03g53340.6
TIGROs03g20340.1
SwissProtQ9SCY5
SwissProtQ9R078
SwissProtQ9QZH4
SwissProtQ84VQ1
SwissProtQ6PAM0
SwissProtP80386
SwissProtP78789
SwissProtO43741
GreenPhylGP000949
InterProIPR032640
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03710.1Ma00_t03710.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03710.1 ID=Ma00_p03710.1|Name=Ma00_p03710.1|organism=Musa acuminata|type=polypeptide|length=110bp
MVGCSKSNLYFRNQRRKFSFSSRITGSYGAEPYTDTPSETSVASALHSSD
SHVSILKTRRDASTDDPWMPNSSRYEDVLDDPGIPTMITWSHGGKEVFVE
GSLDNWKTK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene