Overview
NameMa00_p03690.1
Unique NameMa00_p03690.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length332
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:30412778..30415294 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Owneracenci
Annotator commentremoved last intron; added five prime and three prime UTRs
OriginCIRAD:GSMUA_AchrUn_randomT08120_001
Old locus tagGSMUA_AchrUn_randomG08120_001
Color2
NoteMa00_g03690~ Peroxidase 15~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ43102
TrEMBLQ43049
TrEMBLQ08IT5
TrEMBLC5WRN5
TrEMBLB9SXK5
TrEMBLB9GYK0
TrEMBLB4FUT1
TrEMBLA9PD65
TIGROs10g02040.2
TIGROs10g02040.1
TIGROs03g32050.1
TIGROs03g13210.1
TIGROs03g13200.1
TIGROs03g13180.1
TIGROs01g36240.1
TIGROs01g15830.1
SwissProtQ9LHB9
SwissProtQ9LEH3
SwissProtQ9LDN9
SwissProtQ9FG34
SwissProtQ42578
SwissProtP80679
SwissProtP17179
SwissProtP15232
InterProIPR019793
InterProIPR010255
InterProIPR002016
InterProIPR000823
GreenPhylGP000018
EC1.11.1.7
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03690.1Ma00_t03690.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03690.1 ID=Ma00_p03690.1|Name=Ma00_p03690.1|organism=Musa acuminata|type=polypeptide|length=333bp
MCSSSFSSSSHTIPAALAILLALLLHWSRAQLSPSFYDMTCPGLSDIVLD
VVLQAQISDPRMPASLIRLHFHDCFVDGCDASVLLDNSDTIVSEKDAVPN
ANSARGFDVIDAIKSAVEETCLGVVSCADILALAAEAAVSLSGGPSWEVQ
LGRRDGTTANISGANNLPGPVDTLAVLLSKFAAVGLDDTDLVTLSGAHTF
GRAQCKSFAARLYNYSGTERPDPSLDSAYLALLQDQCPDGEDGTSLNDLD
PTTPDAFDGNYYFNLQNGQGLLLSDQEIYAGAGTAAIVDGYAGDESGFFE
SFAASMINMGNISPLAGSEGEVRLNCRQVNAS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Peroxidase 15Peroxidase 15
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006979response to oxidative stress
Vocabulary: Molecular Function
TermDefinition
GO:0020037heme binding
GO:0004601peroxidase activity