Overview
NameMa00_p03680.1
Unique NameMa00_p03680.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length334
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:30293390..30295165 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT01220_001
Old locus tagGSMUA_AchrUn_randomG01220_001
Color6
NoteMa00_g03680~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GreenPhylGP005829
TrEMBLQ4S6S5
TrEMBLQ1EPC4
TrEMBLC7J0S6
TrEMBLA4QPW8
TIGROs04g08430.1
TIGROs04g07280.1
TIGROs03g61930.3
TIGROs03g61930.2
TIGROs03g61930.1
TIGROs02g46220.1
TIGROs01g68380.2
TIGROs01g68380.1
SwissProtQ9Y2K3
SwissProtQ9FLH0
SwissProtQ3BUY8
SwissProtP42567
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03680.1Ma00_t03680.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03680.1 ID=Ma00_p03680.1|Name=Ma00_p03680.1|organism=Musa acuminata|type=polypeptide|length=335bp
MASPPSSSPSPPPLSGAAGDEVALASSRSSSEERATKALESLMWPHDLDS
TMSESSLGLLRDRYSVPAEFTLIAPEPGQRAWSFGLRWAARAVDNTAPAL
DEGELRALRRLKEILPSSRVIRKITEAWLVEAGLSPVPREMVNLAVVHGG
RLSSAVSPRRQVGPSIGTREAPVDLEDPAGGGLTRGTRVWADGETAAAFV
RGGLHPDLAREMYTLSSDVLLGKSVKSLLWGQHYAMALADRVRDAGRALG
ILCERNAELRKQLEEVRAGVASEAVAAAEQRSSELEAEATRLRAEAGAAG
ERVSSLEAEVLRLRSEAKASEEEKSDLRGRLEGA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene