|
|
Alignments
The following features are aligned
| Aligned Feature | Feature Type | Alignment Location |
|---|
| chrUn_random | chromosome | chrUn_random:30285023..30285481 + |
Analyses
This polypeptide is derived from or has results from the following analyses
| Analysis Name | Date Performed |
|---|
| manual_curation | 2015-04-05 .281687 |
Properties
| Property Name | Value |
|---|
| Inference | {refseq} |
| Owner | musa |
| Annotator comment | to_fill |
| Alternative splicing | to_fill |
| Color | 6 |
| Note | Ma00_g03650~ retrotransposon protein, putative, Ty3-gypsy subclass, expressed~ unknown_gene~ fragment |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ma00_p03650.1 ID=Ma00_p03650.1|Name=Ma00_p03650.1|organism=Musa acuminata|type=polypeptide|length=153bp
MALFGTSDALMCRAFPTTLRGPARAWYSGLKSGTVASFDQLAKDFELNFL
AYARPKPSMALLLGLNQKEDEPLSHFVNRFTMQIRGLPDAHPSLLMQTFM
IGLRPSRFFWSLVERPPVAVPEMLQRASQFIAAETWMIGKREEHRKVKSE
PP* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
| Term | Definition |
|---|
| fragment | fragment |
Vocabulary: CC Evidence
| Term | Definition |
|---|
| automatic | automatic |
Vocabulary: CC Status
| Term | Definition |
|---|
| in_progress | in_progress |
Vocabulary: CC Evidence Code
| Term | Definition |
|---|
| IC_3 | IC_3 |
Vocabulary: Genedb Products
| Term | Definition |
|---|
| retrotransposon protein, putative, Ty3-gypsy subclass, expressed | retrotransposon protein, putative, Ty3-gypsy subclass, expressed |
Vocabulary: CC EC Number
| Term | Definition |
|---|
| no_EC_number | no_EC_number |
Vocabulary: CC Gene
| Term | Definition |
|---|
| unknown_gene | unknown_gene |
|