Overview
NameMa00_p03160.1
Unique NameMa00_p03160.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length337
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:26396209..26400427 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT14370_001
Old locus tagGSMUA_AchrUn_randomG14370_001
Color6
NoteMa00_g03160~ ABC transporter A family member 1~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLD8SUM8
TrEMBLD8SQA6
TrEMBLD7THU8
TrEMBLD7LHA5
TrEMBLD7FZE8
TrEMBLB9SU42
TrEMBLB9H9T2
TrEMBLA5CBI6
TIGROs09g19680.1
TIGROs08g30780.1
TIGROs08g30770.1
TIGROs08g30740.1
TIGROs06g38950.1
TIGROs03g46740.2
TIGROs03g46740.1
TIGROs02g11960.1
SwissProtQ9ESR9
SwissProtQ9BZC7
SwissProtQ86UQ4
SwissProtQ84M24
SwissProtP78363
SwissProtP41233
SwissProtO95477
SwissProtO35600
GreenPhylGP000687
InterProIPR027417
InterProIPR003439
InterProIPR026082
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03160.1 ID=Ma00_p03160.1|Name=Ma00_p03160.1|organism=Musa acuminata|type=polypeptide|length=338bp
MLTKMLILFAVSSAIITACTMGSIFRYSDKSVVFAYFFLFGLSAVMLSFF
ISAFFSRAKTAVAVGTLSFLGAYVPYYTVNDPAVPLVWKMMASLLSPTAF
ALGTVNFADYERAHVGLRWTNVWQASSGVNFLVCLLMMVLDMFLYCSLGL
YFDKILSREDGVWHTWNFLVTTILWIRDKTFANNTGRLDDKQHNEVPGIE
KRWTGQVVCEPAIEAISLDMKQQELDGRCIQVRNLHKVYMTREGKHCAVN
SLEVTLYENQILALLGHNGAGKSTTISMLAGLLPPTSGDAVVFGKNIITN
MYTTITFLYPSCLLEDSLYVVCCVSTKLEHAVTSVGN*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03160.1Ma00_t03160.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
ABC transporter A family member 1ABC transporter A family member 1
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0005215transporter activity
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane