Overview
NameMa00_p03130.1
Unique NameMa00_p03130.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length376
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:25405950..25413069 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteMa00_g03130~ V-type proton ATPase subunit C~ unknown_gene~ complete
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103973232
GenbankXM_009387734.1
InterProIPR004907
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03130.1 ID=Ma00_p03130.1|Name=Ma00_p03130.1|organism=Musa acuminata|type=polypeptide|length=377bp
MAATLRYWIVSLPVHTSASATWNRLRQSISKNSFDTPLYRFTMPDLRVGT
LDSLLALSDDLVKSNAFIEGVTHKIRRQIEELEKASGVEVGALTVDGVPI
DSYLTRFVWDEGKYPTMSPLRELVDSIHVQVAKIEDDMKVRVAEYSNIRS
QLNAINRKQSGSLAVRDISNLVNPEDIVASEHLVTLLAVVPKYSQKDWLS
SYETLTTFVVPRSTKKLHEDNEYALYTVTLFQKVADNFRNNAREKGFQIR
EFEYSPEAQESRKQELEKLIQDQESKRSSLLQWCYASYGEVFSSWMHFCA
VRVFAESILRYGLPPSFLAVVLAPLVKSEKKVRGILEELCGNVNSSYWKS
EDEIGLAGIGGEAEAYPYVSFTINLV*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03130.1Ma00_t03130.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
V-type proton ATPase subunit CV-type proton ATPase subunit C
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
Vocabulary: Biological Process
TermDefinition
GO:0015991ATP hydrolysis coupled proton transport
Vocabulary: Cellular Component
TermDefinition
GO:0033180proton-transporting V-type ATPase, V1 domain